KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038309
Entry
101038309         CDS       T04350                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04110  Cell cycle
sbq04218  Cellular senescence
sbq04934  Cushing syndrome
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05212  Pancreatic cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05220  Chronic myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101038309 (RB1)
   04218 Cellular senescence
    101038309 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101038309 (RB1)
   05203 Viral carcinogenesis
    101038309 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101038309 (RB1)
   05225 Hepatocellular carcinoma
    101038309 (RB1)
   05226 Gastric cancer
    101038309 (RB1)
   05214 Glioma
    101038309 (RB1)
   05220 Chronic myeloid leukemia
    101038309 (RB1)
   05218 Melanoma
    101038309 (RB1)
   05219 Bladder cancer
    101038309 (RB1)
   05215 Prostate cancer
    101038309 (RB1)
   05224 Breast cancer
    101038309 (RB1)
   05222 Small cell lung cancer
    101038309 (RB1)
   05223 Non-small cell lung cancer
    101038309 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101038309 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101038309 (RB1)
   05161 Hepatitis B
    101038309 (RB1)
   05160 Hepatitis C
    101038309 (RB1)
   05163 Human cytomegalovirus infection
    101038309 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101038309 (RB1)
   05169 Epstein-Barr virus infection
    101038309 (RB1)
   05165 Human papillomavirus infection
    101038309 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101038309 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sbq01009]
    101038309 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101038309 (RB1)
Protein phosphatases and associated proteins [BR:sbq01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101038309 (RB1)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    101038309 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 TFIIB
Other DBs
NCBI-GeneID: 101038309
NCBI-ProteinID: XP_003942268
UniProt: A0A2K6TSU6
LinkDB
Position
Unknown
AA seq 926 aa
MPPKMPRKAAAAAAAAEPPAPPPPSSPEEDPEQDSGPEDLPLVRVEFEETEEPDFTALCQ
RLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMPFTFTELQK
IIEISVFKFFDLLKEIDTSTKVDNAMSRLLKKYNVLLALFSKLERTCELIYLTQPNSSIS
TEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPVLLKEPYKTA
VIPVNGSPRTPRRGQNRSARIAKQLENDTRIIEILCKEHECNIDEVKNVYLKNFIPFMNS
LGLVTSNGLPEVESLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFEAQRTPRKSNL
DEEVNVISPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDI
GYIFKEKFAEAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDSIF
HMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGTL
TREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNVALQNNHTA
ADMYLSPVRSPKKKGSATRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRL
NTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFK
IIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPI
PHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPGTRILVSIGESFGTS
EKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLQGESKFQQKLA
EMTSTRTRMQKQKMNDSMDTSNKEEK
NT seq 2781 nt   +upstreamnt  +downstreamnt
atgccgcccaaaatgccccgaaaagccgccgccgccgctgccgccgcggaacccccagcg
ccaccgcctccgtcttctcctgaggaggacccagagcaggacagcggcccggaggacctg
cctctggtcagggttgagtttgaagaaactgaagaacctgattttactgcgttatgtcag
agattaaagataccagatcatgtcagagagagagcttggttaacttgggagaaagtttca
tctgtggatggagtattgggaggttatattcaaaagaaaaaggaactgtggggaatctgt
atctttattgcagcagttgacctagatgagatgccgttcacttttactgaactacagaaa
atcatagaaatcagtgtctttaaattctttgacttattaaaagaaattgataccagtacc
aaagttgataatgctatgtcaagactgttgaagaagtataatgtattattggcactcttc
agcaaattagaaaggacatgtgaacttatatatttgacacaacccaacagttcgatatct
actgagataaattctgcattggtgctaaaagtttcttggatcacatttttattagctaaa
ggggaagtattacaaatggaagatgatctggtgatttcatttcagttaatgctatgtgtc
cttgactattttattaaactctcacctcctgtgttgctcaaagaaccatataaaacagct
gttatacccgttaatggttcacctcgaacacccaggcgaggtcagaacaggagtgcacgg
atagccaaacaactagaaaatgatacaagaattattgaaattctctgtaaagaacatgaa
tgtaatatagatgaggtgaaaaatgtttatttaaaaaattttataccttttatgaattct
cttggacttgtaacatctaatggacttccagaggttgaaagtctgtctaaacgatacgaa
gaaatttatcttaaaaataaagatctagatgcaagattatttttggatcatgataaaact
cttcagactgattctatagacagttttgaagcacagagaacaccacgaaaaagtaacctt
gatgaagaggtgaatgtgatttctccacacactccagttaggactgttatgaacactatc
caacaattaatgatgattttaaattcagcaagtgatcagccatcagaaaatctgatttcc
tattttaacaactgcacagttaatccaaaagaaagtattttgaaaagagtgaaggatatt
ggatacatctttaaagagaaatttgctgaagctgtgggacagggatgtgttgaaattgga
tcacagcgatacaaacttggagttcgcttgtattaccgagtaatggaatccatgcttaaa
tcagaagaagaacgattatccattcaaaattttagcaaacttctaaacgacagcattttt
catatgtctttattggcgtgtgctcttgaggttgtaatggccacatatagcagaagcact
tcccagaatcttgattctggaacagatttgtccttcccatggattctgaatgtgcttaat
ttaaaagcctttgatttttacaaagtgattgaaagttttatcaaagcagaaggcaccttg
acaagagaaatgataaaacatttagaacgatgtgaacatcgaatcatggaatcccttgcg
tggctctcagattcacctttatttgatcttattaaacaatcaaaggaccgagaaggacca
actgatcaccttgaatctgcttgtcctcttaatgttgctctccagaataatcacactgca
gcagatatgtatctttctcctgtaagatccccaaagaaaaaaggttcagctacacgtgta
aattctactgcaaatgcagagacacaagcaacctcagccttccagacccagaagccattg
aaatctacctctctttcactgttttataaaaaagtgtatcggctagcttatctccggcta
aatacgctgtgtgaacgccttctgtctgagcacccagaactagagcatatcatctggacc
cttttccagcacacgctgcagaatgaatatgaacttatgagagacaggcatttggaccaa
attatgatgtgttccatgtatggcatatgcaaagtgaagaatatagaccttaaattcaaa
atcattgtaacagcatacaaagatcttcctcatgctgttcaggagactttcaaacgtgtt
ttgatcaaagaagaggagtatgattctattatagtattctataactcagtcttcatgcag
agactgaaaacaaatattttgcagtatgcttccaccaggccccctaccttgtcaccaata
cctcacattcctcgaagcccttacaagtttcctagttcacccttacggattcctggaggg
aacatctatatatcacccctgaagagtccatataaaatttcagaaggtctgccaacacca
acaaaaatgactccaggaacaagaatcttagtatcaattggtgaatcatttgggacttct
gagaagttccagaaaataaatcagatggtttgtaacagtgaccgtgtgctcaaaagaagc
gctgaaggaagcaaccctcctaaaccgctgaaaaaactacgctttgatatcgaaggatca
gatgaagcagatggaagtaaacacctccaaggggagtccaaatttcagcagaaactggca
gaaatgacatctactcgaacacgaatgcaaaagcagaaaatgaatgacagcatggatacc
tcaaacaaggaagaaaaatga

DBGET integrated database retrieval system