KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038368
Entry
101038368         CDS       T04350                                 

Gene name
ME3
Definition
(RefSeq) NADP-dependent malic enzyme, mitochondrial isoform X4
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00620  Pyruvate metabolism
sbq01100  Metabolic pathways
sbq01200  Carbon metabolism
sbq03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    101038368 (ME3)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101038368 (ME3)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     101038368 (ME3)
SSDB
Motif
Pfam: Malic_M malic
Other DBs
NCBI-GeneID: 101038368
NCBI-ProteinID: XP_003935120
UniProt: A0A2K6STK8
LinkDB
Position
Unknown
AA seq 604 aa
MGAALGTGTRLALRPGRACGALPRWAPSASARGCHAKSGSARPVPLKKRGYDVTRNPHLN
KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL
FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLATMLNSWPEDNI
KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPQQCLPVLLDVGTNNEELLRD
PLYIGLKHQRVRGKAYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCM
FNDDIQGTASVAVAGILAALRITKNKLSSHVFVFQGAGEAAMGIAHLLVMALEKEGVPKA
EATRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVNSLEEVVRLVKPTAIIGVAAIAGA
FTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYRVTEGRGIFASGSPFKSVTLEDGK
TFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLST
IRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYSWPKEAMN
VQTV
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgggcgccgcgctgggcacaggcacgcggctggctctccggcccggccgggcctgcggc
gccctcccgcgctgggcaccctccgcgtctgctcgaggctgccacgccaagtccggctca
gcacgccccgtgcccctgaagaagcgtggatacgatgtcaccaggaaccctcatctcaac
aaggggatggcctttacacttgaagaaaggctgcagcttggaatccacggcctaatcccg
ccctgctttctgagccaggacgtccagctcctccggatcatgagatattacgagcggcag
caaagtgacctggacaagtacatcattctcatgacactccaagaccggaatgagaagcta
ttctaccgagtgctgacctcggatgtggagaagttcatgccgatcgtgtacacacccacg
gtggggctggcctgtcagcactatggcctgaccttccgcagaccccgtggactgttcatc
accattcatgacaagggccaccttgcaacaatgctgaactcttggccagaagacaatatt
aaggccgtggtggtgactgatggggagcgcatcctgggcctgggagacctgggctgctat
ggcatgggcatccctgtgggcaagctggccctgtacacagcgtgtggaggggtgaacccg
caacagtgcctccctgtgctgctggatgtcggcaccaacaatgaggagctgctcagagac
cctctgtacattggcctgaaacaccagcgtgtgcgtgggaaggcgtatgatgacttgctg
gatgaattcatgcaggctgtgacagacaagtttggaataaattgcctcatccagtttgaa
gactttgccaatgccaatgccttccgcctgctcaacaaataccgtaacaagtactgcatg
ttcaatgatgacatccaaggcacagcctccgttgctgtggcagggatcctggctgctctg
cgaatcaccaagaacaagctctccagtcacgtgtttgttttccaaggtgcaggcgaggca
gccatgggcattgcccacctccttgtcatggccctagagaaagaaggtgtaccgaaagca
gaggccacaagaaagatctggatggtggactctaaggggctcattgtcaaggggaggagc
cacctgaaccatgaaaaggagatgtttgcccaagaccatcctgaagtgaactccctggag
gaggtggtgaggctggtgaagcccacagccatcataggtgttgctgccatcgcaggagcc
ttcacggagcagattctgagggacatggcctccttccacgagcgccctatcatctttgcc
ctgagcaaccccaccagcaaggccgagtgcacggctgagaagtgctaccgggtcactgag
ggccgagggatttttgccagtggaagtccttttaagagtgtgactctagaagatggcaag
accttcattcctggtcagggaaacaatgcttatgtgttccctggggtggcactaggagtc
atcgctggcgggatccggcacattccagatgagatcttcctcctgacagcagagcaaatt
gcacaggaagtctctgagcagcatctgtcccaggggagactgtacccaccactcagtacc
atccgagatgtgtctctgagaattgccatcaaagtacttgactacgcgtacaaacacaac
ctggcctcctactacccggagcctaaggacaaggaggcttttgtaagatccctggtctac
actccagactatgactcctttacactggatagttacagttggcccaaagaagccatgaat
gttcagacagtctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039119
Entry
101039119         CDS       T04350                                 

Gene name
ME1
Definition
(RefSeq) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00620  Pyruvate metabolism
sbq01100  Metabolic pathways
sbq01200  Carbon metabolism
sbq03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    101039119 (ME1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101039119 (ME1)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     101039119 (ME1)
SSDB
Motif
Pfam: Malic_M malic Trimer_CC
Other DBs
NCBI-GeneID: 101039119
NCBI-ProteinID: XP_003923020
UniProt: A0A2K6STE2
LinkDB
Position
Unknown
AA seq 497 aa
MDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFISIHDRGHIAS
VLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDV
GTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRL
LNKYRNHYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLILM
AMEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLETIVQEIKPTA
LIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSP
FDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKVFLTTAEVIAQQVSDKHLE
EGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFIRSQMYSTDYDQILPD
CYSWPEEVQKIQTKVDQ
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggatctccaagatagaaatgaaaaactcttttatcgagtgctaacatctgacattgag
aaattcatgcctattgtttatactcccactgtgggtctggcttgccaacaatacagttta
gtgtttcggaagccaagaggtctctttattagtatccatgatcgcgggcatattgcttca
gttctcaatgcatggccagaagatgtcatcaaggccattgtggtgaccgatggagagcgt
attcttggcttgggagatcttggctgtaatggaatgggcatccctgtgggtaaattggct
ctatatacagcttgtggagggatgaatcctcaagaatgtctgcctgtcattttggatgtg
ggaactgaaaatgaggagttacttaaagatccactctacattggactacggcagagaaga
gtaagaggttctgaatatgatgattttttggatgaattcatggaggcagtttcttccaag
tatggcatgaattgccttattcaatttgaagattttgccaatgtgaatgcatttcgtcta
ctgaacaagtatcgaaaccactattgcacattcaatgatgatattcaaggaacagcatct
gttgcagtagcaggtctccttgcagctcttcgaataaccaagaacaaactgtctgatcaa
acaatactattccaaggagctggagaggctgccctagggattgcacacctgattttgatg
gcaatggaaaaagaaggtttaccaaaagaaaaagccatcaaaaagatatggttggttgat
tcaaaaggattaatagttaagggacgtgcttccttaacacaagagaaagagaagtttgcc
catgaacatgaagaaatgaagaatctagaaaccattgttcaagaaataaaaccaactgcc
ctcataggagttgctgcaattggtggtgcattctcagaacaaattctcaaagatatggct
gccttcaatgaacggcctattatttttgctttgagtaatccaactagcaaagcagaatgt
tctgcagagcagtgctataaaataaccaagggacgtgcaatttttgccagtggcagtcct
tttgatccagtcactcttccaaatggacagaccctatatcctgggcaaggcaacaattcc
tatgtgttccctggagttgctcttggtgttgtggcgtgtggattgaggcacatcacagat
aaggttttcctcactactgctgaggttatagctcagcaagtgtcagataaacacttggaa
gagggtcggctttatcctcctttgaataccattagagatgtttctctgaaaattgcagaa
aagattgtgaaagatgcataccaagaaaagacagccacagtttatcctgaaccgcaaaac
aaagaagcatttatccgctcccagatgtatagtactgattatgaccagattctacctgat
tgttattcttggcctgaagaggtccagaaaatacagaccaaagttgaccagtag

DBGET integrated database retrieval system