KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038444
Entry
101038444         CDS       T04350                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 2A, isoforms 1/2/3
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq01524  Platinum drug resistance
sbq04110  Cell cycle
sbq04115  p53 signaling pathway
sbq04218  Cellular senescence
sbq04934  Cushing syndrome
sbq05163  Human cytomegalovirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05206  MicroRNAs in cancer
sbq05212  Pancreatic cancer
sbq05214  Glioma
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05220  Chronic myeloid leukemia
sbq05223  Non-small cell lung cancer
sbq05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101038444
   04115 p53 signaling pathway
    101038444
   04218 Cellular senescence
    101038444
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101038444
   05206 MicroRNAs in cancer
    101038444
   05203 Viral carcinogenesis
    101038444
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101038444
   05225 Hepatocellular carcinoma
    101038444
   05214 Glioma
    101038444
   05220 Chronic myeloid leukemia
    101038444
   05218 Melanoma
    101038444
   05219 Bladder cancer
    101038444
   05223 Non-small cell lung cancer
    101038444
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101038444
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101038444
   05163 Human cytomegalovirus infection
    101038444
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101038444
   01522 Endocrine resistance
    101038444
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank
Other DBs
NCBI-GeneID: 101038444
NCBI-ProteinID: XP_003928239
UniProt: A0A2K6U6M5
LinkDB
Position
Unknown
AA seq 148 aa
MEPSADWLATAAARGRVEEVRALLEAGAPPNAPNSYGRRPIQVMMMGSARVAELLLLHGA
EPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHCDVAG
YLRAAAGGTTGSSPARADAAEGPSDVPD
NT seq 447 nt   +upstreamnt  +downstreamnt
atggagccttccgcggactggctggccacggccgcggcccggggtcgggtggaggaggtg
cgggcgctgctcgaggcgggggcgccgcccaacgcaccgaatagttacggtcggaggccg
atccaggtcatgatgatgggcagtgcccgcgtggcagagctgctgctgctccacggcgcg
gagcccaactgcgcggaccccgccactctcacccgaccggttcacgacgctgcccgggag
ggcttcctggacacgctggtggtgctgcaccgggccggggcgcggctggacgtgcgcgat
gcctggggccgtctgcccgtggacctggctgaggagcggggtcactgcgacgttgcaggg
tacctacgcgcggctgcggggggtaccacaggcagtagccctgcccgcgcagatgccgcg
gaaggtccctcagacgtccccgattga

DBGET integrated database retrieval system