KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038607
Entry
101038607         CDS       T04350                                 

Gene name
APOA1
Definition
(RefSeq) apolipoprotein A-I
  KO
K08757  apolipoprotein A-I
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04975  Fat digestion and absorption
sbq04977  Vitamin digestion and absorption
sbq04979  Cholesterol metabolism
sbq05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101038607 (APOA1)
  09154 Digestive system
   04975 Fat digestion and absorption
    101038607 (APOA1)
   04979 Cholesterol metabolism
    101038607 (APOA1)
   04977 Vitamin digestion and absorption
    101038607 (APOA1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    101038607 (APOA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101038607 (APOA1)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101038607 (APOA1)
SSDB
Motif
Pfam: Apolipoprotein YtxH ApoLp-III DUF1640 DUF948 DUF4455 Exonuc_VII_L DHC_N1 OmpH Gp58 TipAS Bacillus_HBL AbiH DUF5798 PIN_8 DUF3584 RRF Lipoprotein_7 BshC DUF883 SF-assemblin ApoA-II Gp-FAR-1 DUF4407 RasGAP Borrelia_REV Syntaxin_2 Prominin Cytochrom_B562 Sirohm_synth_C YabA Muted T2SSF
Other DBs
NCBI-GeneID: 101038607
NCBI-ProteinID: XP_003923713
UniProt: A0A2K6TRM6
LinkDB
Position
Unknown
AA seq 266 aa
MKAVVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDSVKESGKDYVSQFETS
ALGKQLNLKLLDNWDSLTSTVNKLREQLGPVTQEFWDNLEKETEQLRQEMNKDLEEVKAK
VQPYLDDFQKKWQEEMNLYSQKLEPLRTEFQEGAFQKLQDLREKLRPVAEQVRDRARAHV
DTLRTQLAPYSDELRQRLATRLEALKESGATLAEYQAKASEHLSALGEKAKPAFEDLRQG
LLPVLESFKVSFLSALDEYAKKLSSQ
NT seq 801 nt   +upstreamnt  +downstreamnt
atgaaagctgtggtgctgaccttggccgtgctcttcctgacggggagccaggctcggcat
ttctggcagcaagatgaacccccccagagcccctgggatcgagtgaaggacctggccact
gtgtacgtggattcagtcaaagagagcggcaaagactatgtgtcccagtttgaaacgtcc
gccttgggaaaacagctaaacctgaagctcctggacaactgggacagcttgacctccact
gtcaacaagcttcgcgaacagctcggccctgtgacccaggagttctgggataacctagaa
aaggagacagagcagctgaggcaggagatgaacaaggatctggaggaggtgaaggccaag
gtgcagccctatctggacgacttccagaagaagtggcaggaggagatgaatctctactcc
cagaagttagaaccgctgcgcacggagttccaggagggtgcgttccagaagctgcaggat
ctgcgggagaagctgcgcccggtagcagagcaggtgcgcgaccgcgcgcgcgcccacgtg
gacacgctgcgcacacaactggcaccctacagcgacgagctgcgccagcgcttggccacg
cgcctcgaggcgctcaaggagagcggtgccaccctggccgagtaccaagccaaggccagc
gagcatctgagcgcgctcggcgagaaggccaagcccgcgttcgaggacctccgccagggc
ctgctgccagtgctggagagcttcaaggtcagcttcctgagcgcgctcgatgagtacgcc
aagaaactgagctcccagtga

DBGET integrated database retrieval system