KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038666
Entry
101038666         CDS       T04350                                 

Gene name
GRB2
Definition
(RefSeq) growth factor receptor-bound protein 2
  KO
K04364  growth factor receptor-bound protein 2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04062  Chemokine signaling pathway
sbq04068  FoxO signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04380  Osteoclast differentiation
sbq04510  Focal adhesion
sbq04540  Gap junction
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04714  Thermogenesis
sbq04722  Neurotrophin signaling pathway
sbq04910  Insulin signaling pathway
sbq04912  GnRH signaling pathway
sbq04915  Estrogen signaling pathway
sbq04917  Prolactin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
sbq05034  Alcoholism
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101038666 (GRB2)
   04012 ErbB signaling pathway
    101038666 (GRB2)
   04014 Ras signaling pathway
    101038666 (GRB2)
   04630 JAK-STAT signaling pathway
    101038666 (GRB2)
   04068 FoxO signaling pathway
    101038666 (GRB2)
   04072 Phospholipase D signaling pathway
    101038666 (GRB2)
   04151 PI3K-Akt signaling pathway
    101038666 (GRB2)
   04150 mTOR signaling pathway
    101038666 (GRB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101038666 (GRB2)
   04540 Gap junction
    101038666 (GRB2)
   04550 Signaling pathways regulating pluripotency of stem cells
    101038666 (GRB2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101038666 (GRB2)
   04660 T cell receptor signaling pathway
    101038666 (GRB2)
   04662 B cell receptor signaling pathway
    101038666 (GRB2)
   04664 Fc epsilon RI signaling pathway
    101038666 (GRB2)
   04062 Chemokine signaling pathway
    101038666 (GRB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101038666 (GRB2)
   04912 GnRH signaling pathway
    101038666 (GRB2)
   04915 Estrogen signaling pathway
    101038666 (GRB2)
   04917 Prolactin signaling pathway
    101038666 (GRB2)
   04926 Relaxin signaling pathway
    101038666 (GRB2)
   04935 Growth hormone synthesis, secretion and action
    101038666 (GRB2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101038666 (GRB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101038666 (GRB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101038666 (GRB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101038666 (GRB2)
   05206 MicroRNAs in cancer
    101038666 (GRB2)
   05205 Proteoglycans in cancer
    101038666 (GRB2)
   05203 Viral carcinogenesis
    101038666 (GRB2)
   05231 Choline metabolism in cancer
    101038666 (GRB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101038666 (GRB2)
   05225 Hepatocellular carcinoma
    101038666 (GRB2)
   05226 Gastric cancer
    101038666 (GRB2)
   05214 Glioma
    101038666 (GRB2)
   05221 Acute myeloid leukemia
    101038666 (GRB2)
   05220 Chronic myeloid leukemia
    101038666 (GRB2)
   05211 Renal cell carcinoma
    101038666 (GRB2)
   05215 Prostate cancer
    101038666 (GRB2)
   05213 Endometrial cancer
    101038666 (GRB2)
   05224 Breast cancer
    101038666 (GRB2)
   05223 Non-small cell lung cancer
    101038666 (GRB2)
  09165 Substance dependence
   05034 Alcoholism
    101038666 (GRB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101038666 (GRB2)
   05160 Hepatitis C
    101038666 (GRB2)
   05163 Human cytomegalovirus infection
    101038666 (GRB2)
   05165 Human papillomavirus infection
    101038666 (GRB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101038666 (GRB2)
   01522 Endocrine resistance
    101038666 (GRB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101038666 (GRB2)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sbq04990]
    101038666 (GRB2)
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    101038666 (GRB2)
Domain-containing proteins not elsewhere classified [BR:sbq04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   101038666 (GRB2)
SSDB
Motif
Pfam: SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH2_2 DUF5093
Other DBs
NCBI-GeneID: 101038666
NCBI-ProteinID: XP_010340838
LinkDB
Position
Unknown
AA seq 186 aa
MHNEKDSSWISRFFVGKQMLISLPSFLRWFFGKIPRAKAEEMLSKQRHDGAFLIRESESA
PGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDI
EQMPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVT
PVNRNV
NT seq 561 nt   +upstreamnt  +downstreamnt
atgcacaatgagaaagactccagctggatttcccgtttctttgtggggaagcagatgttg
atcagcttgccttccttccttaggtggttttttggcaaaatcccccgagccaaggcagaa
gaaatgcttagcaaacagcggcacgatggggcctttcttatccgagagagtgagagcgct
cctggggacttctccctgtctgtcaagtttggaaatgatgtgcagcacttcaaggtgctc
cgagatggagctggcaagtatttcctctgggtggtgaagttcaattctttgaatgagctg
gtggattatcacagatctacatctgtctccagaaaccagcagatattcctgcgggacata
gaacagatgccacagcagccgacatacgtccaggccctctttgactttgatccccaggag
gacggagagctgggcttccgccggggagattttatccatgtcatggataactcagacccc
aactggtggaaaggagcgtgccacggccagaccggcatgtttccccgcaactacgtcacc
cctgtgaaccggaacgtctaa

DBGET integrated database retrieval system