KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038696
Entry
101038696         CDS       T04350                                 

Gene name
MET
Definition
(RefSeq) hepatocyte growth factor receptor isoform X2
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04020  Calcium signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04360  Axon guidance
sbq04510  Focal adhesion
sbq04520  Adherens junction
sbq05100  Bacterial invasion of epithelial cells
sbq05144  Malaria
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05211  Renal cell carcinoma
sbq05218  Melanoma
sbq05223  Non-small cell lung cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101038696 (MET)
   04014 Ras signaling pathway
    101038696 (MET)
   04015 Rap1 signaling pathway
    101038696 (MET)
   04020 Calcium signaling pathway
    101038696 (MET)
   04151 PI3K-Akt signaling pathway
    101038696 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101038696 (MET)
   04520 Adherens junction
    101038696 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    101038696 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101038696 (MET)
   05202 Transcriptional misregulation in cancer
    101038696 (MET)
   05206 MicroRNAs in cancer
    101038696 (MET)
   05205 Proteoglycans in cancer
    101038696 (MET)
   05230 Central carbon metabolism in cancer
    101038696 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101038696 (MET)
   05226 Gastric cancer
    101038696 (MET)
   05218 Melanoma
    101038696 (MET)
   05211 Renal cell carcinoma
    101038696 (MET)
   05223 Non-small cell lung cancer
    101038696 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101038696 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    101038696 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101038696 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101038696 (MET)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101038696 (MET)
Protein kinases [BR:sbq01001]
 Receptor tyrosine kinases (RTK)
  MET family
   101038696 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema TIG Pkinase PSI Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 101038696
NCBI-ProteinID: XP_003921107
UniProt: Q09YH7
LinkDB
Position
Unknown
AA seq 1381 aa
MKAPAVLTPGILLLLFTLVQKSNGECKEALTKSEMNVNMKYQLPNFTAETPIQNVILHEH
HIFLGATNYIYVLNEEDLQKVAEHRTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMAL
VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQTEEPSQCPDCVVSAL
GTKVLLSVKERFLNFFVGNTINSSYVPDHSLHSISVRRLKETKDGFMFLTDQSYVDVLPE
FRDSYPIKYVHAFESNNFIYFLAVQRETLNAQTFHTRIIRFCSINSALHSYMEMPLECIL
TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS
AVCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTFQRNFLGCETRRDEYRTEF
TTALQRIDLFAGQFNKVLLTSISTFVKGDLTIANLGTSEGRFIQIVVSRSVPSTPHVNFL
LDSHPVSPEVIVEHPLNHNGYTLVVTGKKITKIPLNGLGCRHFQSCSQCLSAPSFVQCGW
CHDKCVRSEECSSGTWTQETCLPTIYKVFPTSAPLEGGTRLTICGWDFGFRRNNKFDLKK
TRVLLGNESCTLTLSESTMNTLKCTVGPAMNEHFNMSIIISNAHGTTQYSTFSYVDPIIT
SISPRYGPMSGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF
PVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGIGKNLNSVSVPRMVINLH
EARRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV
FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPSDL
LKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISIALLLLLGLFLWLKKRKQ
IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGS
CRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF
NEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL
SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW
HPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSQDNADGELD
T
NT seq 4146 nt   +upstreamnt  +downstreamnt
atgaaggcccctgctgtgcttacacctggcatcctcctgctcctgtttaccttggtgcag
aagagcaatggggagtgtaaagaggcactaacgaagtccgagatgaatgtgaatatgaag
tatcagcttcccaacttcactgcagaaacacccatccagaatgtcattctacatgagcat
cacattttccttggtgccactaactacatttacgttttaaatgaggaagaccttcagaag
gttgctgagcacaggacagggcctgtgctggaacacccagattgtttcccatgtcaggac
tgcagcagcaaagccaatttatcaggaggagtttggaaagataacatcaacatggctctg
gttgtcgacacctactatgatgaccaactcattagctgtggcagcgtcaacagaggaacc
tgccagcgacacgtctttccccacaatcatactgctgacattcagtcggaggttcactgc
atattctccccgcagacagaagagcccagccagtgtcctgactgcgtggtgagcgccctc
ggaaccaaagtccttttatctgtaaaggaacggttcctcaacttctttgtaggcaatacc
ataaattcttcttatgtcccagatcattcgttgcattcaatatcagtgagaaggctaaag
gaaacaaaagacggttttatgtttttgacggaccagtcctacgttgatgttttacctgag
ttcagagattcttaccccattaagtacgtccatgccttcgaaagcaacaattttatttac
ttcttggcggtccaaagggaaactctaaatgctcagacttttcacacgaggataatcagg
ttctgttccataaactctgcactgcattcctacatggaaatgcctctggagtgtattctc
acagaaaagagaaaaaagagatccacaaaaaaggaagtgtttaatatccttcaggctgca
tatgtcagcaagcctggggcccaacttgcgaggcaaataggagccagcctgaatgatgac
attctcttcggggtgtttgcacaaagcaagccagattctgctgaaccaatggatcgatct
gccgtgtgtgcattccctatcaaatatgtcaacgacttcttcaacaagatcgtcaacaaa
aacaacgtgagatgtctccaacatttttacggacccaatcatgagcactgttttaatagg
acatttcagagaaattttttaggctgtgaaacacgccgcgatgaatatcgaacagagttt
accacagctttgcagcgcattgacttattcgcgggtcaattcaacaaagtcctcttaact
tctatatccaccttcgttaaaggagacctcaccattgctaatcttgggacatcagagggc
cgcttcatccagattgtggtttctcgatcagtaccatcaacccctcatgtgaattttctc
ctggactcccacccggtgtctccagaagtgatcgtggagcatccgttaaaccacaatggc
tatacactggttgtcactgggaagaagatcaccaagatcccattgaatggtttgggctgc
agacatttccagtcctgcagtcagtgcctctctgctccttcctttgtgcagtgtggctgg
tgccacgataaatgtgtgcgatcggaggaatgctccagtgggacatggactcaagagacc
tgtctgcctacaatctacaaggttttcccaactagtgcaccccttgaaggagggacaagg
ctgaccatatgtggctgggactttggatttcggaggaataataaattcgatttaaagaaa
actagagttctccttggaaatgagagctgcaccttgaccttaagtgagagcacgatgaat
acattgaaatgcacagttggtcctgccatgaatgagcatttcaatatgtccataattatt
tcaaacgcccacggaacaacacaatatagtacattttcctatgtggatcctataataaca
agtatttccccgagatatggtcctatgtctggtggcactttacttactttaactggaaat
tacctaaacagtgggaattctagacacatttcaattggtggaaaaacatgtactttaaaa
agtgtgtcaaacagtattcttgaatgttataccccagcccaaaccatttcaactgagttt
cctgttaaattgaaaattgacttagccaaccgagagacaagcatcttcagttaccgggaa
gaccctattgtctatgaaattcatccaaccaaatcttttattagtggtgggagcacaata
acgggtattgggaaaaacctgaattcagttagtgttccgaggatggtcataaatctgcat
gaagcaagaaggaactttacagtggcatgtcagcatcgctctaattcagagataatctgc
tgtaccactccttccctgcaacagctgaatctgcaactccccctgaaaaccaaagccttt
ttcatgttagatgggatcctttccaaatactttgatctcatttatgtacataatcctgtg
tttaagccttttgaaaagccagtgatgatctcaatgggcaatgaaaatgtactggaaatt
aagggaaatgatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaataag
agctgtgagaatatacacttacattccgaagccgttttatgcacagtccccagtgacctg
ctgaaattgaacagcgagctaaatatagagtggaagcaagcaatttcttcaaccgttctt
ggaaaagtaatagttcaaccagatcagaatttcacaggattgattgctggtgttgtctca
atctcaatagcgctcttattactacttgggcttttcctgtggctgaaaaaaagaaagcaa
attaaagatctgggcagtgaattagttcgctatgatgcaagagtacacactcctcatttg
gataggcttgtaagtgcccgaagtgtaagcccaactacagaaatggtttcaaatgaatct
gtagactaccgagctacttttccagaagatcagtttcccaactcatctcagaatggttca
tgccgacaagtgcagtatcctctgacagacatgtcccccatcctgactagtggggactct
gatatatccagtccattactgcaaaatactgtccacattgacctcagtgctctaaatcca
gagctggtccaggcagtgcagcatgtagtgattgggcccagtagcctgattgtgcatttc
aatgaagtcataggaagagggcattttggttgtgtgtatcatgggactttgttggacaat
gatggcaagaaaattcactgtgctgtgaaatccttgaacagaatcacggacataggagaa
gtttcccagtttctgaccgagggaatcatcatgaaagattttagccatcccaatgtcctc
tcgctcctgggaatctgcctgcgaagtgaagggtctccgctggtggtcctaccatacatg
aaacatggagatcttcgaaatttcattcgaaatgagactcataatccaactgtaaaagat
cttattggctttggtcttcaagtagccaaaggcatgaaatatcttgcaagcaaaaagttt
gtccacagagacttggctgcaagaaactgtatgctggatgaaaaattcactgtcaaggtt
gctgattttggtcttgccagagatatgtatgataaagaatactatagtgtacacaacaaa
acaggtgcaaagctgccagtgaagtggatggctttggaaagtctacaaactcaaaagttt
accaccaagtcagatgtgtggtcctttggcgtgctcctctgggagctgatgacaagagga
gccccaccttatcctgatgtgaacactttcgatataactgtttacctgttgcaagggaga
aggctcctacaacccgaatactgcccagaccccttatatgaagtcatgctaaaatgctgg
caccctaaagctgaaatgcgcccatccttttctgaactggtgtcccggatatccgcgatc
ttctctactttcatcggggaacactatgtccatgtgaacgctacttatgtgaacgtaaaa
tgtgtggctccatatccttctctgttgtcatcacaagataacgctgacggcgagctggac
acctga

DBGET integrated database retrieval system