KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038759
Entry
101038759         CDS       T04350                                 

Gene name
USP7
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 7 isoform X1
  KO
K11838  ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04068  FoxO signaling pathway
sbq05169  Epstein-Barr virus infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101038759 (USP7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101038759 (USP7)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101038759 (USP7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sbq01002]
    101038759 (USP7)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    101038759 (USP7)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101038759 (USP7)
Peptidases and inhibitors [BR:sbq01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   101038759 (USP7)
Ubiquitin system [BR:sbq04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    101038759 (USP7)
SSDB
Motif
Pfam: USP7_ICP0_bdg USP7_C2 UCH UCH_1 MATH
Other DBs
NCBI-GeneID: 101038759
NCBI-ProteinID: XP_010337497
LinkDB
Position
Unknown
AA seq 1044 aa
MEDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFF
LQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTD
PEKGFIDDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQL
RKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQE
LCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKK
NIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQN
IKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWC
KFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQ
QLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLK
NSSLAEFVQNLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPW
TIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLP
VMCDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNS
ELPTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQ
FFKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIW
LNSQFREEEITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDEL
LECLSPATSRTFRIEEIPLDQVDIDKENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFR
EVMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLG
LDHFNKAPKRSRYTYLEKAIKIHN
NT seq 3135 nt   +upstreamnt  +downstreamnt
atggaggatgacaccagttggcgctccgaggcaacctttcagttcactgtggagcgcttc
agcagactgagtgagtcggtccttagccctccgtgttttgtgcgaaatctgccatggaag
attatggtgatgccacgcttttatccagacagaccacaccaaaaaagcgtaggattcttt
ctccagtgcaatgctgaatctgattccacgtcgtggtcttgtcatgcacaagcagtgttg
aagataataaattacagagatgatgaaaaatcgttcagtcgtcgtattagtcatttgttc
ttccataaagaaaatgattggggattttccaattttatggcttggagtgaagtgactgat
cctgagaaaggatttatagacgatgacaaagtaacctttgaagtctttgtacaggcggat
gctccccatggagttgcgtgggattcaaagaagcacacaggctatgtcggcttaaagaat
cagggagcgacttgttacatgaacagcttgctacagacgttatttttcacaaatcagcta
cgaaaggctgtgtacatgatgccaaccgagggggatgattcgtctaaaagcgtcccttta
gcgttacaaagagtgttctatgaattacagcacagtgataaacctgtaggaacaaaaaag
ctaacaaagtcatttgggtgggaaactttagatagcttcatgcaacacgatgttcaggag
ctttgtcgagtgttgcttgataatgtggaaaataagatgaaaggcacctgtgtagagggc
accatacccaaattattccgtggcaaaatggtgtcctatatccaatgtaaagaagtagac
tatcggtctgatagaagagaagattattatgatatccagctaagtatcaaaggaaagaaa
aatatatttgaatcatttgtggattatgtggcagtagaacagcttgatggggacaataag
tacgacgctggggaacatggcttacaggaagcagagaaaggtgtgaaattcctaacattg
ccaccagtgttacatctacaactgatgagatttatgtatgaccctcagacggaccaaaat
atcaagatcaatgataggtttgaattcccagagcagttaccacttgatgaatttttgcaa
aaaacagatcccaaggaccctgcaaattatattcttcatgcagtcctggttcatagtgga
gataatcatggtggacattatgtggtttacctgaaccccaaaggggatggcaaatggtgt
aaatttgatgacgacgtggtgtcaaggtgtactaaagaggaagcaattgagcacaattat
ggcggtcatgatgacgacctgtctgtccgacactgcactaatgcttacatgttagtctat
atcagggaatcaaaactgagtgaagttttacaggcggtcaccgaccatgatattcctcag
cagttggtggagcgattgcaagaagagaaaaggatcgaggctcagaagcggaaggagcgg
caggaagcccatctctatatgcaagtgcagatagtcgcagaggaccagttttgtggccac
caaggaaatgacatgtacgatgaagaaaaagtgaaatacactgtattcaaagtattgaag
aactcctcgcttgccgagtttgttcagaacctctctcagaccatgggatttccacaagat
caaattcgattatggcccatgcaagcaaggagtaatggaacaaaacgaccagcaatgtta
gataacgaagccgacggcaataaaacaatgattgagctcagtgataatgaaaacccttgg
acaatattcctggaaacagtcgatcccgagctggctgctagtggagcgaccttacccaag
tttgataaagatcatgatgtaatgttatttttgaagatgtatgatcccaaaacgaggagt
ttgaattactgtgggcatatctacacaccaatatcctgtaaaatacgtgacttgctccca
gttatgtgtgacagagcaggatttattcaagatactagccttatcctctatgaggaagtt
aaaccgaatttaacagagagaattcaggattatgacgtttctcttgataaagcccttgat
gaactaatggatggtgacatcatagtatttcagaaggatgaccctgaaaatgataacagt
gaattacccaccgcaaaggaatatttccgagatctctaccaccgcgttgatgtcattttc
tgtgataaaacaatccctaatgatcctggatttgtggttacgttatcaaatagaatgaat
tattttcaggttgcaaagacagttgcacagaggctcaacacagatccaatgttgctccag
tttttcaagtctcaaggttatagggatggcccaggtaatcctcttagacataattatgaa
ggtactttaagagatcttctacaattcttcaagcctagacaacctaagaaactttactat
cagcagcttaagatgaaaatcacagactttgagaacaggcgaagttttaaatgtatatgg
ttaaacagccagtttagggaagaggaaataacactatatccagacaagcatgggtgtgtc
cgggacctgttagaagaatgtaaaaaggccgtggagcttggggagaaggcgtcagggaaa
cttaggctgctagaaattgtaagctacaaaatcattggtgtccatcaagaagatgaacta
ttagaatgtttatctcctgcaacgagccggacgtttcgaatagaggaaatccctttggac
caggtggacatagacaaagagaatgagatgcttgtcacagtggcacattttcacaaagag
gtcttcggaacgttcggaatcccatttttgctgaggatacaccagggcgagcattttcga
gaagtgatgaagcgaatccagagcctgctggacatccaggagaaggagttcgagaagttt
aaatttgcaattgtaatgatgggccgacaccagtacataaatgaagatgagtatgaagta
aatttgaaagactttgagccacagcccggtaacatgtctcatcctcggccttggctaggg
ctcgaccacttcaacaaagccccaaagaggagtcgctacacttaccttgaaaaggccatt
aaaatccataactga

DBGET integrated database retrieval system