KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038765
Entry
101038765         CDS       T04350                                 

Gene name
TBPL2
Definition
(RefSeq) TATA box-binding protein-like protein 2
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03022  Basal transcription factors
sbq05016  Huntington disease
sbq05017  Spinocerebellar ataxia
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    101038765 (TBPL2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101038765 (TBPL2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101038765 (TBPL2)
   05017 Spinocerebellar ataxia
    101038765 (TBPL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101038765 (TBPL2)
   05165 Human papillomavirus infection
    101038765 (TBPL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101038765 (TBPL2)
   03021 Transcription machinery [BR:sbq03021]
    101038765 (TBPL2)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    101038765 (TBPL2)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     101038765 (TBPL2)
  RNA polymerase III system
    TFIIIB
     101038765 (TBPL2)
  RNA polymerase I system
    SL1/TIF-1B
     101038765 (TBPL2)
SSDB
Motif
Pfam: TBP
Other DBs
NCBI-GeneID: 101038765
NCBI-ProteinID: XP_010339430
LinkDB
Position
Unknown
AA seq 353 aa
MASAPRPERAPRLLAPCLTRYPPPPSPTTVGFLSMEEEETYLELYLNQCAAQDGLAPPRS
PLFSPVVPYDMYMLNASNPETAFNLNPEVKETSGGFSPVDLSFLPDELTQEDKDQPVIGS
KHETKENSESQSQQSRLPSSSEQDIGLGLNSPSLSNPHSQRHPSDTDLVQASPEKPDSNS
LPLASITPMSPVTSVSECCGIVPQLQNIVSTVNLACKLDLKKIALHAKNAEYNPKVRFLT
SEEQSRLAARKYARVVQKLGFPARFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEP
ELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERSEICEAFENIYPILKSFKKA
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggcgtctgcaccccggcccgagcgggctccgaggctgctagctccgtgcttaacacgg
tatccgccgccgccctcacccacgacagtgggatttctgtccatggaggaggaggagacc
tacctggagctttacctgaaccagtgcgccgctcaggatggccttgccccacccaggtct
cccctgttcagcccagttgtaccttatgatatgtacatgctgaatgcatccaatccagag
actgcatttaatttgaaccctgaagtcaaagaaacatctggtggtttctcacctgtggat
cttagcttcctaccagatgaacttacccaagaagataaagaccagcctgtaattggaagc
aaacatgaaactaaagaaaattctgaaagccaaagtcaacaaagtaggttgccatcatcc
agtgaacaggacattgggctgggcttaaacagccccagtttgtcaaatcctcattcacag
cggcaccctagtgatactgacttggtccaggcctctcctgagaaaccagactccaactcc
ttgcctctggcatccataactcccatgtcaccggtgacctctgtttcagagtgttgtgga
attgtacctcaactacagaatatagtttccactgtaaacctggcctgtaagttggatctc
aagaaaatagctttgcatgcaaaaaatgcagaatataacccaaaggtaagatttctcacc
agtgaagagcagtctcgacttgcagcaagaaaatatgcccgcgtggtgcagaagcttggg
ttccctgccagattcctcgattttaaaattcagaacatggttggaagctgtgatgtgaaa
tttcccatcaggctggaaggtttggtgctaacccatcagcagttcagtagttatgagcct
gaactgtttcctggtcttatttatagaatggtaaaaccacgaattgtgttgcttatcttt
gtatctggaaaagttgtgttgacaggtgccaaagaacgttctgagatctgtgaagcattt
gaaaacatctatcctattctaaaaagttttaaaaaagcctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040658
Entry
101040658         CDS       T04350                                 

Gene name
TBP
Definition
(RefSeq) TATA-box-binding protein
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03022  Basal transcription factors
sbq05016  Huntington disease
sbq05017  Spinocerebellar ataxia
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    101040658 (TBP)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101040658 (TBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101040658 (TBP)
   05017 Spinocerebellar ataxia
    101040658 (TBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101040658 (TBP)
   05165 Human papillomavirus infection
    101040658 (TBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101040658 (TBP)
   03021 Transcription machinery [BR:sbq03021]
    101040658 (TBP)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    101040658 (TBP)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     101040658 (TBP)
  RNA polymerase III system
    TFIIIB
     101040658 (TBP)
  RNA polymerase I system
    SL1/TIF-1B
     101040658 (TBP)
SSDB
Motif
Pfam: TBP CDK2AP EPL1 Spt20 DDHD DUF2722 TFIIA V_ATPase_I Presenilin ABC2_membrane_2 Cnd2 EBP50_C PAT1
Other DBs
NCBI-GeneID: 101040658
NCBI-ProteinID: XP_003943481
UniProt: A0A2K6UIT2
LinkDB
Position
Unknown
AA seq 326 aa
MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQ
QQQQQQQQQQQQQQQQQAVAAAAVQQSTSQQATSQQATQGTSGQAPQLFHSQTLTTAPLP
GTTPLYPSPVTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYN
PKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDF
KIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLT
GAKVRAEIYEAFENIYPILKGFRKTT
NT seq 981 nt   +upstreamnt  +downstreamnt
atggatcagaacaacagcctgccgccttatgctcagggcttggcctcccctcagggtgcc
atgactcctggaatcccaatctttagtccaatgatgccttatggcactggactgacccca
cagcctattcagaacaccaatagtctgtctattttggaagagcaacaaagacagcagcag
cagcagcagcagcagcaacagcagcagcaacaacagcagcaacagcagcaggcagttgca
gccgcagccgttcagcagtcgacatcccagcaggcaacgtcccagcaggcgacacaggga
acctcaggccaggcaccacagctcttccactcacagactctcacaactgcacccttgcca
ggcaccactccactgtatccctcccctgtgacccccatgacccccatcactcctgccaca
ccagcttctgagagctctgggattgtaccgcagctgcaaaatattgtatccacagtgaat
cttggttgtaaacttgacctaaagaccattgcacttcgtgcccgaaatgccgaatataat
cccaagcggtttgctgccgttatcatgaggataagagagccacgaaccacggcactgatt
ttcagttctgggaaaatggtgtgcacaggagccaagagtgaagaacagtccagactggca
gcaagaaaatatgctagagttgtacagaagttgggttttccagctaagttcttggacttc
aagattcagaacatggtggggagctgtgatgtgaagttccctataaggttagaaggcctt
gtgctcacccaccaacagtttagtagttatgagcctgagttatttcctggtttaatctac
agaatgatcaaacccagaattgttcttcttatttttgtttctggaaaagttgtattaaca
ggtgctaaagtcagagcagaaatttatgaagcatttgaaaacatctaccctattctaaag
ggattcaggaaaacgacgtaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101046128
Entry
101046128         CDS       T04350                                 

Gene name
TBPL1
Definition
(RefSeq) TATA box-binding protein-like protein 1
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03022  Basal transcription factors
sbq05016  Huntington disease
sbq05017  Spinocerebellar ataxia
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    101046128 (TBPL1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101046128 (TBPL1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101046128 (TBPL1)
   05017 Spinocerebellar ataxia
    101046128 (TBPL1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101046128 (TBPL1)
   05165 Human papillomavirus infection
    101046128 (TBPL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101046128 (TBPL1)
   03021 Transcription machinery [BR:sbq03021]
    101046128 (TBPL1)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    101046128 (TBPL1)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     101046128 (TBPL1)
  RNA polymerase III system
    TFIIIB
     101046128 (TBPL1)
  RNA polymerase I system
    SL1/TIF-1B
     101046128 (TBPL1)
SSDB
Motif
Pfam: TBP DUF3378
Other DBs
NCBI-GeneID: 101046128
NCBI-ProteinID: XP_003932505
UniProt: A0A2K6SX68
LinkDB
Position
Unknown
AA seq 186 aa
MDAESDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATI
WSSGKIICTGATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEF
TKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFE
SRKEIL
NT seq 561 nt   +upstreamnt  +downstreamnt
atggatgcagagagtgacgttgcattggacattctaattacaaatgtagtctgtgttttt
agaacaagatgccatttgaacttaaggaagattgctttggaaggagcaaatgtaatttat
aaacgtgatgttggaaaagtattaatgaagcttagaaaacctagaattacagctacaatt
tggtcctcaggaaaaattatttgcactggagcaacaagtgaagaagaagctaaatttggt
gccagacgtttagcccgcagtctgcagaaactaggttttcaggtaatatttacagatttt
aaggttgttaacgttttggcagtgtgtaacatgccatttgaaatccgtttgccagaattc
acaaagaacaatagacctcatgccagttatgaacctgaacttcatcctgctgtgtgctat
cggataaagtctctaagagctacgttacagattttttcgacgggaagtatcacagtaaca
gggcccaatgtaaaggctgttgctactgctgtggaacagatttacccatttgtgtttgaa
agcaggaaagaaattttataa

DBGET integrated database retrieval system