KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038807
Entry
101038807         CDS       T04350                                 

Gene name
SORBS1
Definition
(RefSeq) sorbin and SH3 domain-containing protein 1 isoform X1
  KO
K06086  sorbin and SH3 domain containing protein 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04520  Adherens junction
sbq04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101038807 (SORBS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101038807 (SORBS1)
   03320 PPAR signaling pathway
    101038807 (SORBS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sbq04990]
    101038807 (SORBS1)
Domain-containing proteins not elsewhere classified [BR:sbq04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   101038807 (SORBS1)
SSDB
Motif
Pfam: SH3_9 SH3_1 SH3_2 Sorb
Other DBs
NCBI-GeneID: 101038807
NCBI-ProteinID: XP_010331546
LinkDB
Position
Unknown
AA seq 1344 aa
MSSECDGGSKAVVNGLAPSSNGQDKATAYPLRARSISAVKIIPVKTVRNASGLVLPPGIS
LDMDPTKICTGKGAVTLRASSSYRETPSSSPVSPQETPQHESKPDEWRPSSNADANGNAQ
PSSLAAKGYRSVHPNLPSDKSQDATSSSAAQPEVIVVPLYLVNTDRGQEGTARSPAPLGP
LGRVPTIPATASAASPLTFPTLDDFIPPHLQRWPHHSQPARTTGSFAPISQTPPSFSPPP
PLVPPAPEDLHRVSEPDLTGAVSSTDSSPLLNEVSSSLVGTDSQAFPPVSKPSSAYPSTT
IVNPTIVLLQHNREQQKRLSSLSDTVSERRVGEQDSAPTQEKPTSPARAAEKRAKDDSRR
VVKSAQDLSDVSMDEVGIPLRNTERSKDWYKTMFKQIHKLNRDTPEENPYFPTYKFPELP
EIQQTSEEDNPYTPTYQFPASTPSPKSEDDDSDLYSPRYSFSEDTKSPLSVPRSKSEMSY
IDGEKVVKRSATLPLPARSSSLKSSPERNDWEPPDKKVDTRKYRAEPKSIYEYQPGKSSV
LSNEKMSRDISPEEIDLKNEPWYKFFSELEFGKPPPKKIWDYTPGDCSILPREDRKTNLD
KDLNLCQTELEADLEKMETLNKAPSANVPQSSAISPTPEISSETPGYIYSSNFHAVKRES
DGAPGDLTSLENERQIYKSVLEGGDIPLQGLSGLKRPSSSASTKDSESPRHFIPADYLES
TEEFIRRRHDDKEKLLADQRRLKREQEEADIAARRHTGVIPTHHQFITNERFGDLLNIDD
TAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRT
YIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWY
EGRIPGTSRQGIFPITYVDVIKRPLVKNPVDYVDLPFSSSPSRSATASPQFSSHSKLITP
APSSLPHSRRALSPEMHAVTSEWISLTVGVPGRRSLALTPPLPPLPETSVYNTDHLALSP
RASPSLSLSLPHLSWSDRPTPRSVASPLALPSLHRTYSLAPSSQASLHINGDGGVHQDSF
SQLPLGSSDSVISQLSDAFSSQSNRQPWREESGRYERKAEREAGERGPGGPKISKKSCLK
PSDVVRCLSTEQRLSDLNTPEESRPGKPLGSAFPGSEAEQTERHRGGEQAGRKAARRGGS
QLSHHSLRAGPDLTESEKSYVEAVCNEIINIAEKSVHYCSTVSHPLDFHHKVSPSDNKSS
LIISQQPQAQQRRITPDRSQTSQDLFSYQALYSYIPQNDDELELRDGDIVDVMEKCDDGW
FVGTSRRTRQFGTFPGNYVKPLYL
NT seq 4035 nt   +upstreamnt  +downstreamnt
atgagctctgaatgtgatggtggttcgaaagctgtggtgaatggcttggcacccagcagt
aatgggcaagacaaagcaactgcctaccctttacgtgcacgctctatttctgctgttaaa
atcattcctgtgaagacagtgagaaacgcctcaggcctagttctccctccaggtatctcc
ttggacatggatcctacgaaaatctgcactggaaagggagcagtgactctccgggcctcg
tcttcctatagggaaacaccaagcagtagccctgtgagtcctcaggaaaccccgcaacac
gaaagcaaaccagatgagtggaggccttcttccaatgctgatgccaatggaaatgcccag
ccctcttcactcgctgccaagggctacagaagtgtgcatcccaacctaccttccgacaag
tcccaggatgccacttcctccagtgcagcccagccggaggtaatagttgtccctctctac
ctggttaacactgacagagggcaagaaggcacggccagatcgccagcacctctggggcct
cttggccgcgtccccacaatcccagcgaccgcctctgcagcctcacctctgaccttcccg
actctagatgatttcattccccctcatctgcagaggtggccccaccacagccagccagcc
cgcaccactggctcctttgcccccattagccagacgccaccatccttctcaccaccacct
ccgctggtccctcccgccccggaggacctccacagagtctcggagcctgacctcacggga
gctgtttcgagtaccgattccagtcctctactaaatgaagtttcttcttcccttgttgga
actgattcccaagcctttccaccagttagcaagccttcgtccgcctatccctccacaaca
attgtcaatcctactattgtgctcttacaacacaatcgagaacagcaaaaacgactcagt
agcctttcagatactgtctcagaaagaagagtgggagagcaggactcagcaccaacccag
gaaaaacccacctcacctgccagggctgctgaaaaaagagcaaaggatgacagtaggcgg
gtggtgaagagcgctcaggacctaagcgatgtttccatggatgaagtgggcatcccactc
cggaacactgagcgatcaaaagactggtacaagactatgtttaaacagatccacaaacta
aacagagacactcctgaagaaaacccttatttccctacgtacaaattccctgaacttcct
gaaatccagcaaacttctgaagaggacaatccttacactcctacctaccagtttcctgca
tctactcctagtcctaaatctgaagatgatgattcagatctgtactctccaagatactcg
ttttctgaagacacaaaatctcccctttctgtgcctcgctcaaaaagtgagatgagctac
attgatggtgagaaggtagtcaagaggtcagccacactacccctcccagcccgctcttcc
tcactgaaatcaagcccagaaagaaatgactgggaacccccagataagaaagtagataca
agaaaataccgtgcagagcccaaaagcatttacgaatatcagccgggcaaatcttccgtt
ttgagcaacgaaaagatgagtcgggatataagcccagaagagatagatttaaagaatgaa
ccttggtataaattcttttcggaattggagtttgggaaaccgcctcccaaaaagatatgg
gattatactcctggagactgctctatccttcctagagaggatagaaagactaatctagac
aaagatctcaacctctgccagacagagttagaggcagatttagaaaaaatggagacgctt
aataaagcacccagtgcaaacgtgccacagagctcagctatcagccccactccggaaatt
tcttcagagactcctggatacatatattcttccaacttccatgcagtgaagagggaatca
gacggggctcctggggatctcactagcttggagaatgagagacaaatttacaaaagtgtc
ttggaaggtggcgacatccctcttcagggcctgagtgggctcaagcgaccatccagctca
gcttccacaaaagattcagaatcgccaagacattttataccagctgattacttggaatcc
acagaagaatttattcgaagacgtcatgatgataaggagaaacttttagcggaccagaga
cgacttaagcgcgagcaagaagaggctgatattgcagctcgacgccacacgggcgtcatt
ccgacgcaccatcagtttatcactaatgagcgctttggggacctcctcaatatagacgat
accgcaaaaaggaaatctgggtcagagatgagacctgccagagccaagtttgactttaaa
gctcagacactaaaggagcttcctctgcagaagggagatattgtttacatttataagcaa
attgatcagaactggtatgaaggagaacaccacggccgggtaggaatcttcccacgcacc
tacattgagcttcttcctcctgctgagaaggctcagcccaaaaagttgacaccagtgcag
gttttggaatatggagaagctattgctaagtttaactttaatggtgatacacaagtagaa
atgtccttcagaaagggtgaaaggattacactgctccggcaggtagatgagaactggtac
gaagggaggatcccagggacatcccgacaaggcatcttccccatcacctacgtggatgtg
atcaagcggccactggtgaaaaaccccgtggattacgtggacctgcctttctcctcctcc
ccaagtcgcagtgccactgcgagcccacagttttccagtcacagcaagctcatcacgcca
gccccctcatctctgccccactcccgccgagccctgtcccctgagatgcacgctgtcacc
tctgagtggatctcactgactgtgggggtcccaggcaggcgttctctggccctgacccca
cccttgcctcctctgccagagacttctgtctataacactgaccacctcgccttgtccccg
agggccagtccctccctgtctctcagcctcccgcatttgagttggtccgatcgtcctacc
ccacgatcagtagcttctccactggccctaccttccctgcacagaacctactccctagca
cccagttcccaggcctcccttcacatcaatggagacggtggcgtccaccaagatagcttc
tcgcagctgccgctggggagctctgatagtgtcatctcccagcttagtgatgcctttagc
agccagagcaacaggcagccgtggcgcgaagagagcggacgatatgagaggaaagcagag
agggaggcaggcgagagaggccctggtggacccaagatctctaagaagagctgcttgaag
ccttcagacgtggtcaggtgcctgagtactgaacagagactctcagatctcaacacccct
gaggagagccggcccggcaagcccctgggtagcgcttttccaggaagtgaggctgagcag
acagagcggcatagaggtggcgagcaggcggggaggaaagctgctcgcagaggtgggagc
cagctttctcatcattcattgagagcaggacctgatctcacagaatctgaaaagagctat
gtggaagcggtttgcaatgagatcataaacattgccgaaaaatctgttcattactgcagc
actgtttctcatccccttgactttcatcacaaggtatccccttctgacaataaatcatct
ttaatcatttctcagcaacctcaagcccagcagcgaagaatcacgcccgacagaagtcaa
acctcacaagatttatttagctatcaagcattatatagctatataccacagaatgatgat
gagttggaactccgagatggagacattgttgatgtcatggaaaaatgtgacgatggatgg
tttgttggtacttcaagaaggacaaggcagtttggtacttttccaggcaactatgtaaaa
cctttgtatctataa

DBGET integrated database retrieval system