KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039003
Entry
101039003         CDS       T04350                                 

Gene name
PLIN1
Definition
(RefSeq) perilipin-1
  KO
K08768  perilipin-1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04371  Apelin signaling pathway
sbq04714  Thermogenesis
sbq04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101039003 (PLIN1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101039003 (PLIN1)
   03320 PPAR signaling pathway
    101039003 (PLIN1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101039003 (PLIN1)
SSDB
Motif
Pfam: Perilipin
Other DBs
NCBI-GeneID: 101039003
NCBI-ProteinID: XP_010348072
UniProt: A0A2K6UYD7
LinkDB
Position
Unknown
AA seq 510 aa
MAVNKGPTLLDGDVPQEQENVLQRVLQLPMVSGTCECFQKTYTSTKEAHPLVASVCNAYE
KGVQSAGSLAAWSMEPVVRRLSTQFTAANELACRGLDHLEQKIPALQYPPEKIASELKDT
ISTRLLSARNSISVPIASTSDKVLGAALTGCELAWGVARDTAEFAANTRAGRLASEGADL
ALGSIEKVVEYLLPPGKTESAPAPGHQQAQKPPKAKLSLVHRVGALTNTISRHTMKTVAR
ALEQGHTLAMWIPGVAPLSSLAQWGASVAMEVVSRRKSEVRVPWLHNLATQEEDREDQTD
TEGEETEEEEESETEEKKFSEVAALPGPQGLLGNVAHTLQKALQTTISAVTWAPAAVLGM
AGRVLHLTPAPAVTSTKGRAMSLSDALKGVTDNVVDTVVHYVPLPRLSLMEPESEFRDIE
HPPPETERRASGAQSPGPEPAPRPAQPRGNLRRARSPGPEDEADPPAAPRAFPAVPREKP
KRRVSDSLFRPSVLEPILGRAQYSQLRKKS
NT seq 1533 nt   +upstreamnt  +downstreamnt
atggcagtcaacaaaggccccaccttgctggatggagacgtccctcaggagcaggagaac
gtgctacagcgggtcctgcagctgcccatggtgagtggcacctgcgagtgcttccagaag
acctacaccagcaccaaggaagcccacccactggtggcctctgtgtgcaatgcctacgag
aagggcgtgcagagcgctgggagcctggcagcctggagcatggagccagtggtccgcagg
ctgtccacccagttcacagctgccaacgagctagcctgccggggcctggaccacctggag
caaaagatcccagcccttcagtaccctcctgaaaagattgcttctgagctgaaggacacc
atctccacccgcctcctcagcgccagaaacagcatcagcgtgcccatcgccagcacttca
gacaaggtcctgggggccgctctgactgggtgcgagcttgcctggggagtggccagagac
actgcggaatttgctgccaacacccgagctggccggctggcttccgaaggggccgatctg
gccttaggcagcattgagaaggtggtggagtacctcctcccgccaggcaagacagagtca
gcccctgctcctggacaccagcaagcacagaagcctcccaaggccaagctgagccttgtg
cacagggttggggctctgaccaacaccatctctcgacacaccatgaagaccgtggcccgg
gccctggagcagggccacaccctggccatgtggatcccgggtgtggcgcccctgagcagc
ctggcccagtggggtgcgtcagtggccatggaggtggtgtcccggcggaagagcgaggtt
cgggtgccctggctgcacaacctcgccacccaggaggaggatcgtgaggaccagacagac
acggaaggagaggagacagaggaggaggaagaatcagagactgaagagaagaagttcagt
gaggtagcagccctgccaggccctcagggcctcctgggcaatgtggcacacaccctgcag
aaggccctccagaccaccatctcggctgtgacgtgggcacctgcagctgtgctgggcatg
gcagggagggtgctgcacctcaccccagccccggccgtcacctccaccaaggggagggcc
atgtcgctatcagacgccctgaagggtgttactgacaacgtggtggacacagtggtgcac
tacgtgccgctccccaggctgtcgctgatggagcccgagagcgagttccgggacatcgag
cacccgccccccgagacggagcgcagggcgtcgggagcgcagtccccgggccctgagccc
gccccgcgccccgcccagccccgcgggaaccttcgccgcgcacggagccccggcccggag
gacgaggctgaccctcccgctgcgccgcgcgcgttcccggcagtgccccgggagaagccg
aagcgcagggtcagcgacagcctctttcgccctagcgtcctggagcccatcctgggccgc
gcgcagtacagccagctgcgcaagaaaagctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039532
Entry
101039532         CDS       T04350                                 

Gene name
PLIN4
Definition
(RefSeq) perilipin-4
  KO
K20254  perilipin-4
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101039532 (PLIN4)
SSDB
Motif
Pfam: Perilipin ACP_syn_III
Other DBs
NCBI-GeneID: 101039532
NCBI-ProteinID: XP_003939029
LinkDB
Position
Unknown
AA seq 1256 aa
MSAPDEGSRDPPKPKGKTLGSFFGSLPGFSSARNLVANAHSSVRARSAADTLGAPTAEAA
RPQAEVAAHPEQTAQWTEELQPSGKQMVSGAKDLVCSKMSRAKDAVSSGVASVVGAAKGV
VQGGLDTTRSALTGTKEAVSSGVTGAVDGAKGAIHGGLDTSKAVLTGTKDTVSAGLTGAV
NMAKGTVQIGVDTSKTVLTGTKDTVCSAVTGAVNVAKGTVQGGLDTTKSALTGTKDAVST
GVTGAVNLAKGTIQTGVDTSKAVLTGTKDTVCSGVTGAMNTAKGAVQTGVDTTKTVLTGT
KDTVCSGVTGAVNVAKGAIQGGLDTTKSVVMGTKDTVSTGSKTVLTGTKDAVSTGLTGAV
NMAKGTIQTGIDTTKTVLTGTKDTVCSGVTGAMKVAKGAVEGGLDTTKSVVMGTKDTVST
GLMGTANVAKGAVQTGVDTAKTVLTGTKDTVTTGLIGAVNVAKGTVQTGVDTSKTVLTGT
KDTVCSGVTGAVNVAKGAVHGGLDTTKSVLTGTKDAVSTGVTGAMNLAKGTIQTGVDTSK
AVLTGTKEAVCTGVTGVVNVAKGAVQTGVDTTKTVLTGTKDTVCSGVTGAMNVAKGAVQT
GLKTTQNIATGTKNTVGSGVTSAVNMAKGAIQGGLDTTKSVAMGTKDTVSTGLTGAANVA
KGAVQTGVDTAKTLLTGTKDTVTTGLMGAVNVAKGTAQTGMDTSKTVLTGTKDTVCSGVT
SAMNLAKGTIHTGMDTTKTVLTGTKDTVCSGVTGAVNVAKGAIQGGLDTTKSVVMGTKDT
VSTXXXXXXNMAKGTIQTGMDTTKTVLTGTKDTVCSGVTGATSVAKGAIQGGLDTTKSVL
IGTKDAVSTGLTGAVNLAKGTVQTGVDTSKTVLTDTKDTICTGVTGAMSMAKGAIQGGLD
TTKTVLTGTKDAVSAGLMGSGNVVTGAIHTGLNTFQNWLPSTQATSWGGLTSARTTDGGG
EQTALSPREAQFSGVSRPPDVLTVGPEPAWEATATAKGLAPDVATFTQGATSGEEDTGPL
ATTPGPEEARRLAMLRDELEGLGDIFYPMNVDEQAQLAASQPGPKVLSAEQGSYFVRLGD
LAPSFRQRAFEHAVSHLQHGQFQARDALAQLRDCFKLIQKAQPPTEGQPCLDQGSGASVE
DAAVQKEQDAGALSRVCGLLRQLHRAYSGLASSLQGLPAELQQPVGRARHSLCQLYSVVA
SAGSLKELHAERLGQSLEDMQKAWEGLEQLLESVQHNPRLSWLVGPFALPPGGQQL
NT seq 3771 nt   +upstreamnt  +downstreamnt
atgtctgctccagatgaagggagccgggatccccccaaacccaagggcaagaccctgggc
agcttctttgggtccctgcctggcttcagctctgcccggaacctggtggccaacgcgcac
agctcagtgagagcccggtcagccgccgacaccctgggagctcctactgccgaggctgcc
cgaccacaggctgaggtagctgcccacccagagcagacggctcaatggacagaggagctg
cagccttcgggaaagcagatggtgtccggggccaaagacctggtgtgttccaagatgtcc
agggccaaggacgctgtctcctccggggtggccagtgtggtgggcgcagctaagggagtg
gtccagggagggctggataccacccggtctgcactcacgggcaccaaggaggcggtgtcc
agcggggtcacgggggctgtggatggggctaagggcgccatccatgggggcctggacacc
tcgaaggctgttctcactggcaccaaggacacagtgtctgccgggctcacgggggcagtg
aacatggccaaagggactgtccagatcggggtggacacctccaagactgtgctaacgggt
accaaggacaccgtctgcagtgcggtgaccggtgctgtgaatgtggcgaaagggactgtc
caagggggcctggacacgacaaaatctgccctgactggcactaaagacgctgtgtccacc
ggagtcacgggggcagtgaacttggccaaaggaaccatccagactggcgtggataccagt
aaggctgtgctgaccggcaccaaggacaccgtctgtagtggggtgactggtgccatgaac
actgccaaaggggccgtccagacaggtgtggacaccaccaagaccgtcctcactggtacc
aaggacaccgtctgcagtggggtgactggtgccgtgaacgtggccaagggggccatccag
gggggcctggacaccaccaagtctgtggtcatgggtacgaaagacacagtgtccaccggc
tccaagaccgtgctgaccggcaccaaagatgctgtgtccactggactcacaggggccgtg
aatatggccaaaggaaccatccagaccggcatagacaccaccaagactgtcctaaccggt
accaaggacaccgtctgcagtggggtgactggtgccatgaaagtggccaagggagctgtc
gaggggggcctggacaccaccaagtctgtggtcatgggtacaaaagacacagtgtccact
gggctcatggggacagcaaatgtggccaagggggccgtccagacaggtgtagacacagcc
aagaccgtgctgaccggcaccaaggacacagtgactactgggctcatcggggcggtgaat
gtcgccaaagggactgtgcagactggcgtggacacctccaagaccgtcctaacgggtacc
aaggacaccgtctgcagtggggtgacaggtgccgtgaatgtggccaagggggccgtccat
gggggcctggacactacaaagtctgtcctgactggtactaaagacgctgtgtccacggga
gtcaccggggcaatgaacttggccaaagggaccatccagaccggcgtggacacgagtaag
gctgtgctgacaggtaccaaagaggctgtttgcactggggtgacgggtgtcgtgaatgtg
gccaaaggggccgtccagacgggtgtggacaccaccaagaccgtcctaactggtaccaag
gacaccgtctgcagtggggtgaccggtgccatgaatgtggccaaaggggctgtgcaaact
ggactgaaaacgacccaaaatatcgcgacaggtacaaagaacaccgttggcagtggagtg
accagtgctgtgaacatggccaagggggccattcaggggggcctggacaccaccaagtct
gtggccatgggtacgaaagacacagtgtccactgggctcacgggagcagcaaatgtggcc
aagggggccgtccagacgggtgtagacacagccaagactctgctgactggcaccaaggac
acagtgactactgggctcatgggggcagtgaatgtcgccaaagggaccgcccagaccggc
atggacacctccaagactgtgctgaccggtaccaaggacaccgtctgcagtggggtgacc
agtgccatgaacttggccaaaggaaccatccatactggcatggacaccaccaagaccgtc
ctcactggtaccaaggacaccgtctgcagtggggtgaccggtgccgtgaacgtggccaag
ggggccatccaggggggcctggacaccaccaagtctgtggtcatgggtacgaaagacaca
gtgtccacnnnnnnnnnnnnnnnnntgaatatggccaaaggaaccatccagaccggcatg
gacaccaccaagactgtcctaaccggtaccaaggacaccgtctgcagtggggtgactggt
gccaccagtgtggccaaaggggccatccaggggggcctcgacacaacaaagtctgtcctg
attggcactaaagacgctgtgtccactgggctcacaggggcagtgaacttggccaaaggg
actgtccagactggtgtggacacctccaagactgtgctcacggataccaaggacaccatc
tgcactggggtcaccggtgccatgagcatggccaaaggggccatccaggggggcctggac
accaccaagacggtgctgaccggaaccaaagacgcagtgtctgctgggctcatggggtcg
gggaacgtggtgacaggggccatccacactggcctcaacaccttccagaactggctacct
agtacccaggccacctcctggggtggactcaccagtgccaggaccacggacgggggtggg
gagcagactgccctgagccccagagaggcccagttctctggtgtctccaggcccccagat
gtgctcacagtaggcccggagcctgcctgggaagccacagccactgccaagggccttgca
cctgatgtggccacattcacccaaggggccacctcaggtgaggaggacacggggcccttg
gccaccacacccggccctgaagaagctcggcgcttggcaatgttgcgagatgagttggag
gggctaggtgacatcttttaccccatgaatgtggacgagcaagctcagctggctgcctcc
cagcccgggccaaaggtgctgtcagccgaacaggggagctacttcgttcgcttgggtgac
ctggctcccagcttccgccagcgggcatttgaacacgcagtgagccatctgcagcatggc
cagttccaagccagggacgctctggcccagctccgtgactgcttcaagctgattcaaaag
gcccagccgcctacggaagggcagccgtgtctggaccagggctccggtgccagcgtggag
gacgctgctgtccagaaggagcaggatgctggggctctgtccagggtctgtggcctcctc
cggcagctgcaccgggcttacagcggcctggcctccagcctccagggcctgcctgccgag
ctccagcagccagtggggcgggcgcggcacagcctctgccagctctacagcgtggtggcc
tcggcaggctctctaaaggagctgcacgcagagcgcctgggacagagcctcgaggacatg
cagaaggcgtgggaggggctggagcagctactggagagcgtgcagcacaatccccggctc
agctggctggtggggcccttcgccctgccccctggggggcagcagttgtaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039699
Entry
101039699         CDS       T04350                                 

Gene name
PLIN2
Definition
(RefSeq) perilipin-2
  KO
K17284  perilipin-2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101039699 (PLIN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101039699 (PLIN2)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   101039699 (PLIN2)
SSDB
Motif
Pfam: Perilipin SH3BP5
Other DBs
NCBI-GeneID: 101039699
NCBI-ProteinID: XP_003928183
UniProt: A0A2K6UAA3
LinkDB
Position
Unknown
AA seq 437 aa
MASVAVDPQPSVVTRVVNLPLVSSTYDLMSSAYVNTKDQYPYLKSVCEMAEKGVKTITSV
ALTSALPIIQKLEPQIAIANTYACKGLDRMEERLPILNQPSTQVVANAKDAVTGAKDAMT
TTVTGAKDSVASTITGVMDKTKGAVTGSVEKTKSVVSGSINTVLGSRMMQLVSSGVENAL
TKSELLVEQYLPLTEEELEKEAKKVEGFDMVHKPSYYVRLGSLSTKLRSRAYQQALSTVK
EAKQKSQETISQLHSTVQLIEFARKNVHNANQKIQDAQDKLYLSWVEWKRSIGYDDTDES
HCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGLPQNIQDQAKHIGVMASDIYSVFRNA
ASFKEVSDSLLTSSKGQLQKMKESLDDVMDYFVNNTPLNWLVGPFYSQMTESQNAQDQGA
EMDKSSQEAQQSEHKTH
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggcatctgttgcagttgatccacaaccgagtgtggtgactcgggtggtcaacctgccc
ttggtgagctccacatatgacctcatgtcctcagcctatgtcaacacaaaggaccagtat
ccctacttgaagtctgtgtgtgagatggcagagaagggcgtgaagaccatcacctcggta
gccctgaccagtgctctgcccatcatccagaagctagagccgcaaattgcgattgccaat
acctatgcctgtaaggggctagacaggatggaggagagactgcctattctgaatcagcca
tcaactcaggttgttgccaatgccaaagatgctgtgactggggcaaaagatgccatgacg
acaactgtgactggggccaaggattccgtggccagcacgatcacaggggtgatggacaag
accaaaggggcagtgactggcagtgtggagaagaccaagtctgtggtcagtggcagcatt
aacacagtcttggggagtcggatgatgcagcttgtgagcagtggcgtagaaaatgcactc
accaaatcagagctgttggtagagcagtacctccctctcactgaagaagaactagaaaaa
gaagcaaaaaaagttgaaggatttgatatggttcacaaaccaagttattatgttagactg
ggatccctgtctaccaagcttcgctcccgtgcctaccagcaggctctcagcacggttaaa
gaagctaagcaaaaaagccaagagacaatttctcagctccattctactgttcagctgatt
gaatttgccaggaagaatgtgcataatgccaatcagaaaattcaggatgctcaggataaa
ctctacctctcatgggtggagtggaaaaggagcattgggtatgatgatactgatgagtcc
cactgtgctgagcacatcgagtcacgtactcttgctattgcccgaaacctgactcagcag
ctccagaccacgtgccacaccctcctgtccaacatccaaggcttaccacagaacatccaa
gatcaggccaagcacataggggtgatggccagcgacatctactcagtgttccgcaatgct
gcctcctttaaggaagtgtctgacagcctcctcacttctagcaaggggcagctgcagaaa
atgaaggaatctttagatgatgtgatggattattttgttaacaacacgcccctcaactgg
ctggtaggtcccttttattctcaaatgactgagtctcagaatgctcaggaccaaggtgca
gagatggacaagagcagccaggaggcccagcaatctgagcacaaaactcattaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039862
Entry
101039862         CDS       T04350                                 

Gene name
PLIN5
Definition
(RefSeq) LOW QUALITY PROTEIN: perilipin-5
  KO
K20255  perilipin-5
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101039862 (PLIN5)
SSDB
Motif
Pfam: Perilipin FUSC
Other DBs
NCBI-GeneID: 101039862
NCBI-ProteinID: XP_010347954
LinkDB
Position
Unknown
AA seq 451 aa
PQNVVQRVAALPLVRATCTVVCDAYSSAKDRHPLLGSACRLAEQCVCGLTTRALDHAQPL
LEHLQPQLATVNSLACRGLDKLEEKLPFLQQPSETVPWVTGCGDLRWQARGEAGGRAGWC
QPNGLMSVKRSGEFGKLASGPGGGRADVEGMGRAHPALSLASCPPAALAAEAEGPEVGSV
EDQRRQQGYFVRLGSLSARIRHLAYEHSLGKLRQSKHRAQDTLAQLQETLELIDHMQCGV
TPTTPARPGKVHELWGHWSQCPPENGRRSQAELETLVLSRSLTQELQGTVEALEFSVRGL
PPSAQEKVAEVRRSVDALQTAFADARCFGDVPAAALAEGRGRVARAHACVDELLELVVQA
VPLPWLVGPFAPILVERSEPLPDLEAQVDEVIGGPDPRWAHLDWPAQQRAWEAQHGDGDR
DGVGSAGDICEQEPEAPSRPVKHTLMPELDF
NT seq 1356 nt   +upstreamnt  +downstreamnt
ccacagaacgtggtgcagcgcgtggcggctctgcccctggtcagggccacgtgcactgtg
gtctgcgatgcttacagctcagccaaggacaggcatccgctgctggggtccgcctgccgc
ctggctgagcagtgcgtgtgtggcctgaccacccgtgccctggaccacgcccagccgctg
ctcgagcacctgcagccccagctggccaccgtgaacagtctcgcctgcaggggcctggac
aagctggaggagaagcttccctttctccagcaaccttcagagacggtaccctgggtgacc
ggctgtggggacctccggtggcaggccagaggagaggcgggagggagggcgggatggtgc
caaccaaatgggttgatgtcagtcaagaggagcggtgaatttgggaaactggcttctgga
cctggaggcgggcgagcggatgtggaggggatgggccgtgctcaccccgctctgtccctg
gcatcctgtcctccagcggcactggcggctgaggctgagggcccggaagtgggatcagtg
gaagatcagaggagacagcagggctattttgtgcggcttggctcactgtcagcgcggatc
cgccacctggcctatgagcactctctggggaaactgaggcagagcaaacaccgcgcccag
gacacactggcccagctgcaggagactctcgagctgatagaccacatgcagtgcggggtg
acccccaccaccccggcccgccccgggaaggtgcatgagctgtgggggcactggagccag
tgccctccggagaacggccgccggagccaggcagagctggagacgctggtgctatcccgc
agcctgacccaggagcttcagggcacggtagaggcgctggaattcagtgtgcggggccta
ccccctagtgcccaggagaaggtggctgaagtgcggcgtagcgtggacgccctgcagacc
gccttcgccgacgcccgctgctttggggatgtgccggcggccgcgctggccgagggccgg
ggtcgtgtggctcgggcgcacgcctgcgtggacgagctgctggagctggtggtgcaggcc
gtgccgttgccctggctggtgggacccttcgcgcccatccttgtggagcgatctgagccc
ctgccggatctggaggcccaggtggatgaggtcattgggggccctgacccccgctgggca
cacctggactggccggcccagcagagagcctgggaggcccagcacggggatggggacagg
gacggggtgggcagcgccggggacatctgtgagcaggagcccgaggcccccagccgcccg
gtcaagcacaccctgatgccggagctggacttctga

DBGET integrated database retrieval system