KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039092
Entry
101039092         CDS       T04350                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101039092 (IL3RA)
   04151 PI3K-Akt signaling pathway
    101039092 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101039092 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101039092 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101039092 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101039092 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101039092 (IL3RA)
   04090 CD molecules [BR:sbq04090]
    101039092 (IL3RA)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL3 receptor family
   101039092 (IL3RA)
CD molecules [BR:sbq04090]
 Proteins
  101039092 (IL3RA)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N Tissue_fac IL4Ra_N
Other DBs
NCBI-GeneID: 101039092
NCBI-ProteinID: XP_010334275
LinkDB
Position
Unknown
AA seq 474 aa
MGLGSESQGWGCAGGYKTAAGGMEASLSLWRSFLQRKQENHGNVQSWGHRPRMGTPRAFC
TGARKAASPTRDFRLHLRHLGPERAAFPMVLLWLTLLLMPGPGLLQTNQMTKPAIRNLRV
EATTQTLTWDVDGNVTGIQCQKGPDYGIHAMSDRYCQFEAISFCEVTNYSVTAASPPFSA
WILFPEAGGNPQAAAQNLTCWVHGVDLMTCSWAVGPEAPGDVQYHLSVSHRDGQEQHLCV
HYNRNQRGTHIGCVFSDISGISRGSPSAFILVTGSSEAFRVPCVDQLVVFSVIEILTPPN
LTAKCNKTHSFMEWKMRSHFNRDFHYELQIQKSKQPVITEQVKGITSFQLLNPGTYTVRI
RAQEIYEQFWSAWSSHQRFECDQEEDPHTRAWRTSLLIALGTLLAVLCAVLLCKRYLVME
RLFPRLPHMKDPMGNGFRNDKLVRCVSRQGRELGAWRALWEAEAGGQLEARQWR
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgggccttgggtctgagtcccaggggtggggctgcgcgggaggttataaaacggctgca
ggggggatggaagcttcgctttctctttggagaagcttcctgcagcgcaaacaggaaaat
cacgggaacgtgcagagttggggacacaggcctcggatggggacacctcgggccttctgc
accggagctaggaaggctgcttctcccacacgggacttccgtctgcatttaaggcacctc
ggtcctgagagagctgcgttccccatggtcctcctgtggctcacgctgctgctgatgccc
gggcccggcctcctgcaaaccaaccagatgacaaagcccgccatcaggaacttaagggtg
gaagccacaactcagacgttgacatgggatgtggatgggaatgtgaccggtattcagtgc
cagaaaggtccagactatggaatacatgcgatgagtgatcgctactgccagttcgaagcc
atttccttctgtgaggtgaccaactacagcgtcacggccgccagcccgcccttctcggcc
tggatcctcttcccggaggccggtgggaatccgcaggcagccgcgcagaacctgacgtgc
tgggtccacggggtggacctgatgacctgcagctgggccgtgggtcccgaggcccccggg
gacgtccagtaccacctgtcggtcagccatcgcgatggccaggagcagcacctctgtgtc
cactacaacaggaatcagcgagggactcacattggctgcgtgttcagtgacatctctggc
atctccagagggtcgccatcagcctttatcctagtgacgggctccagcgaggccttccgc
gtcccctgcgtagaccagcttgtcgtgttttcggtgattgagatactaactccgcccaac
ttgaccgccaagtgtaataaaacacattctttcatggagtggaaaatgagaagtcatttc
aatcgcgactttcactatgagcttcagatacaaaagagcaagcagcctgtaatcacagaa
caggtcaaaggcataacctccttccagctgctcaatcccggaacgtacacagtgagaata
agagcccaggaaatctatgagcaattctggagcgcctggagcagccaccagcgctttgag
tgtgatcaggaggaggacccgcacacccgagcctggcggacgtcactgctcatcgcgctg
gggacgttgctggccgtgctctgtgctgtcctgctctgcaaaaggtacctcgtgatggag
agactgtttccccgtctccctcacatgaaagaccccatggggaacggcttccgaaacgac
aagctggtacgttgtgtttcccgccaagggagggagctgggggcgtggcgggcactttgg
gaggctgaggcaggtggacagctggaggccaggcagtggaga

DBGET integrated database retrieval system