KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039294
Entry
101039294         CDS       T04350                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1 isoform X1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01524  Platinum drug resistance
sbq04014  Ras signaling pathway
sbq04064  NF-kappa B signaling pathway
sbq04115  p53 signaling pathway
sbq04137  Mitophagy - animal
sbq04140  Autophagy - animal
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04215  Apoptosis - multiple species
sbq04621  NOD-like receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq05012  Parkinson disease
sbq05014  Amyotrophic lateral sclerosis
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05145  Toxoplasmosis
sbq05162  Measles
sbq05166  Human T-cell leukemia virus 1 infection
sbq05168  Herpes simplex virus 1 infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05212  Pancreatic cancer
sbq05220  Chronic myeloid leukemia
sbq05222  Small cell lung cancer
sbq05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101039294 (BCL2L1)
   04630 JAK-STAT signaling pathway
    101039294 (BCL2L1)
   04064 NF-kappa B signaling pathway
    101039294 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    101039294 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101039294 (BCL2L1)
   04137 Mitophagy - animal
    101039294 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    101039294 (BCL2L1)
   04215 Apoptosis - multiple species
    101039294 (BCL2L1)
   04115 p53 signaling pathway
    101039294 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101039294 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101039294 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    101039294 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101039294 (BCL2L1)
   05225 Hepatocellular carcinoma
    101039294 (BCL2L1)
   05220 Chronic myeloid leukemia
    101039294 (BCL2L1)
   05222 Small cell lung cancer
    101039294 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101039294 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    101039294 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    101039294 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101039294 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    101039294 (BCL2L1)
   05162 Measles
    101039294 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    101039294 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101039294 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101039294 (BCL2L1)
   01524 Platinum drug resistance
    101039294 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sbq01009]
    101039294 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sbq03036]
    101039294 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbq02000]
    101039294 (BCL2L1)
Protein phosphatases and associated proteins [BR:sbq01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101039294 (BCL2L1)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    101039294 (BCL2L1)
Transporters [BR:sbq02000]
 Other transporters
  Pores ion channels [TC:1]
   101039294 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 101039294
NCBI-ProteinID: XP_010340855
UniProt: A0A2K6UWY8
LinkDB
Position
Unknown
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSEMETPSAINGNPAWHLA
DSPAVNGATGHSSSLDAREVIPMAAIKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacaggactgaggccccagaaggg
actgattcggagatggagacccccagtgccatcaatggcaacccagcctggcacctggcg
gacagccccgcggtgaatggagccacgggccacagcagcagtttggatgcccgggaggtg
atccccatggcagcaataaagcaagcactgagggaggcaggcgacgagtttgaactgcgg
taccggcgggcatttagtgacctgacatcccagctccacatcacccccgggacagcgtat
caaagctttgaacaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtagacaaggagatgcaa
gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggacacttttgtggaactctatggaaacaatgcagca
gccgagagcagaaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg
gccggcgtggttctgctgggctcactctttagtcggaaatga

DBGET integrated database retrieval system