KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039370
Entry
101039370         CDS       T04350                                 

Gene name
NLRP4
Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101039370 (NLRP4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:sbq04054]
    101039370 (NLRP4)
Membrane trafficking [BR:sbq04131]
 Autophagy
  Other autophagy associated proteins
   Others
    101039370 (NLRP4)
Pattern recognition receptors [BR:sbq04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   101039370 (NLRP4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 VirE ResIII AAA_14 SRP54
Other DBs
NCBI-GeneID: 101039370
NCBI-ProteinID: XP_003944087
LinkDB
Position
Unknown
AA seq 986 aa
MAASFFSDFGLMWYLEELKKEEFRKFKEHLKQLTSHLELKPIPWAEVKKASREELADLLI
KHYEEQQAWNVTLRIFQKMGRKDLCVKVTRERTGYTKTYQDHAKQKFSRLWSSKSVTDIH
QYFHQEVKQEECDHLDRLFASKETGKHPRTVVIQGVQGIGKTTLLMKLMWAWSDSRIYRD
RFLYAFYFCCREMRELPAVSLADLICREWPDPAAPVTEILSQPERLLFVIDSFEQLEADV
NQPDSDLCGDWKEKRPVQVVLISLLRKKMLPQASLLVAVKPTCPKELRDRVAISEIYEPR
GFNESDRLVYFCCFFQDPKRAMEAFSLVRESQQLFAICQIPLLCWLLCTALKQEMQRGKD
LAVTCQSTTSVYASFIFNLFTPEGAAGPTEQSQRQLKGLCALAAEGMWTDTFEFGDEDLR
RHGIADADIPALLGTKVLLKFGERASSYAFIHMCIQEFCAAMFYLLKSHLDHPHPAVRSV
EELLVDNFKKVRRPHWIFLGCFLIGLLNKKEQEKLNGFFGFQLSREIRQQFEQCLKRLGE
QGDLQGQVDALAIFYCLFEMQEPAFVRQAVNLLQEGSFHIVDSSDLVVSAYCLKYCSSLR
KLSFSVQNVFKKEDTHSSVSDYSLICWYHICSVFTTNGYLREVQVQDSTLSEPAFVTWCN
QLRHPSCRLQKLGINNVSFSGQSSHLFEVLFHQPDLKYLSLTLTKLSRDDVKSLCDVLNS
PAGNIEELALVSCELSPVDCEVFAFVLTKNKKLKYLNVSCNRIDEGVRHLCEALCRPDTV
LTYLMLAYCHLSEQCWEYICEMLLRNSSLRHIDLGANVLKDEGLKTLCKALKRPDCRLDS
LCLVKCFITAAGCEDLASVLISNQNLKNLEIGCNEIGDVGAKLLCGALTHPDCRVEVLGL
EDCALTSTCCKDLASVLTSSKTLQQLNLTLNALDHGGVVVLCEALRHPECALRVLGLKKA
DFGEETQALLMAEEERNPKLTIVDHL
NT seq 2961 nt   +upstreamnt  +downstreamnt
atggcagcctctttcttctctgattttggccttatgtggtatctggaggagctcaaaaag
gaggagttcagaaaatttaaggaacatctcaagcaattgacttcacatcttgaactcaag
ccaattccctgggctgaagtcaaaaaagcatcccgggaagaacttgcagacctcttgatc
aagcactatgaagagcagcaggcttggaacgtgaccttaagaatctttcaaaagatgggt
agaaaggatctttgcgtgaaggtcacgagagagaggacagggtatacgaagacctatcaa
gatcacgcaaagcagaagttcagccgcttgtggtccagcaagtctgtcactgatattcac
cagtactttcaccaggaagtcaaacaggaagaatgtgaccatttggaccgcctttttgct
tccaaggaaaccgggaaacacccacgtacagtggtcattcagggagtgcaagggattggg
aagacgacgctcctgatgaagctgatgtgggcctggtcggacagcaggatctaccgggac
aggttcctgtacgccttctacttctgctgccgagaaatgagggagttgccagccgtgagc
ttggctgacttgatctgcagggagtggcccgaccctgccgctcctgtaacagagatcctg
tcccagccagagcgactcctgttcgtcatcgacagcttcgaacagctggaggccgacgtg
aaccagcccgactcggatctgtgtggcgactggaaggagaagcggccggtgcaggtggtc
ctgatcagtttgctgaggaagaagatgctcccgcaggcctccctgctggtcgccgtcaaa
cccacgtgcccgaaggagctccgggatcgggtggcgatctcagaaatatacgagccccgg
ggattcaatgagagcgacagattggtgtacttctgctgtttctttcaagacccaaagaga
gccatggaagccttcagtctcgtgagagagagtcagcagctttttgccatatgccaaatc
ccgctcctctgctggctcctgtgtaccgctctgaagcaagagatgcagagagggaaggac
ctggctgtgacctgccagagcaccacctctgtgtacgcctccttcatcttcaacctgttc
acacccgagggtgccgcggggccgaccgagcaaagccagcgccagctgaagggcctgtgc
gccctggctgcagagggcatgtggaccgatacgtttgagtttggagacgaagacctcagg
agacacgggatcgcggatgctgacatccctgcgttgctgggcaccaaggttcttctgaag
ttcggggagcgggcgagctcctacgcgttcatccacatgtgtatccaggagttctgcgcc
gccatgttctacctactcaagagccaccttgaccatcctcatccagctgttcgcagtgtc
gaggaattgctagttgacaactttaaaaaagtgaggagaccacattggatttttttgggg
tgttttctcattggtcttttaaataaaaaggaacaagaaaaactgaacgggttttttggc
ttccaactgtcccgagagataaggcagcaatttgagcagtgcctgaagcgcttaggggag
cagggggatctgcagggacaggtggatgccttggcgatattctactgtctcttcgagatg
caggagcctgcctttgtgaggcaggccgtgaacctccttcaagaaggtagcttccatatt
gtcgacagctcagacttggtagtttctgcctactgcttaaaatactgctccagcttgagg
aagctttctttttccgtgcagaatgtctttaagaaagaggatacacacagctctgtgtcg
gattacagcctcatctgctggtatcacatctgctctgtgttcactaccaacgggtacctc
agagaggtccaggtgcaggacagcaccctcagtgagccggcctttgtgacctggtgtaac
cagctgaggcaccccagctgtcgccttcagaagctcgggataaataatgtttccttttct
ggtcagagtagtcacctctttgaagtgctctttcatcagccagatttgaaatacctgagc
ctcaccctcaccaaactctctcgtgatgatgtcaagtccctctgtgatgtgttgaactcc
ccagcgggcaacatagaagagctagcgctggtcagttgtgaactctcaccagtggattgt
gaagtctttgccttcgttctgaccaagaacaagaagctcaagtatctgaacgtatcctgc
aaccgcatagacgagggtgtgcgccatctgtgtgaagccctgtgccgcccagacacggtc
ctgacatacctgatgttggcttactgtcacctcagcgagcagtgctgggagtacatctgt
gaaatgcttctgcgtaacagcagtctgcgccacatagatctcggcgctaatgtgctgaag
gatgaaggtctgaaaaccctctgcaaggccttgaaacgcccagactgccgcctcgattcg
ctgtgtttggtaaaatgttttatcactgctgctggctgtgaagacctcgcctcggttctc
atcagcaatcagaacctgaagaatctggaaattgggtgcaacgaaataggagatgtgggc
gcgaagctgctgtgtggggcgctgacgcaccctgattgccgcgtagaggttctcgggttg
gaagactgtgcgttgacaagcacctgctgtaaggatctcgcatctgttctcaccagcagt
aagaccctgcagcagctaaacctgaccttgaacgccttggaccacggaggggtggttgtg
ctctgtgaggccctgagacacccagagtgtgccctgagggtgctcgggctgaaaaaagct
gattttggtgaggaaacgcaggcacttctgatggctgaggaagagagaaatcccaaattg
acaatcgtagaccacctctga

DBGET integrated database retrieval system