KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039462
Entry
101039462         CDS       T04350                                 

Gene name
EML4
Definition
(RefSeq) echinoderm microtubule-associated protein-like 4 isoform X2
  KO
K15420  echinoderm microtubule-associated protein-like 4
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq05200  Pathways in cancer
sbq05223  Non-small cell lung cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101039462 (EML4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101039462 (EML4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    101039462 (EML4)
Cytoskeleton proteins [BR:sbq04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EMAP
     101039462 (EML4)
SSDB
Motif
Pfam: WD40 HELP SlyX Ribosomal_S7
Other DBs
NCBI-GeneID: 101039462
NCBI-ProteinID: XP_003926828
UniProt: A0A2K6UV55
LinkDB
Position
Unknown
AA seq 981 aa
MDGFAGSLDDSISAASTSDVQDRLSALESRVQQQEDEITVLKAALADVLRRLAISEDHVA
SVKKSVSNKGQPSPRAAIPMSCITNGSGANRKPSQTSAVSIAGKETLSSAAKSGTEKKKE
KPQGQREKKEESHSNDQSPQIRASPSPQPSSQPLQIHRQTSESKNATPTKSIKRPSPAEK
SHHSWENSDDSRNKLSKIPPTPKLIPKVTKNADKHKDVIINQEGEYIKMFMRGRPITMFI
PSDVDNYDDIRTELPPEKLKLEWAYGYRGKDCRANVYLLPTGEIVYFIASVVVLFNYEER
TQRHYLGHTDCVKCLAIHPDKIRIATGQIAGVDKDGRPLQPHVRVWDSVTLSTLQIIGLG
TFERGVGCLDFSKADSGVHLCVIDDSNEHMLTVWDWQKKAKGAEIKTTNEVVLAVEFHPT
DANTIITCGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFLGNGDVLTGDSGGVML
IWSKITVEPTPGKVPKGIYQISKQIKAHDGSVFTLCQMRNGMLLTGGGKDRKIILWDHDL
NPEREIEVPDQYGTIRAVAEGKADQFLVGTSRNFILRGTFNDGFQIEVQGHTDELWGLAT
HPFKDLLLTCAQDRQVCLWNSVEHRLEWTRLVDEPGHCADFHPSGTVVAIGTHSGRWFVL
DAETRDLVSIHTDGNEQLSVMRYSVDGTFLAVGSHDNFIYLYVVSENGRKYSRYGRCTGH
SSYITHLDWSPDNKYIMSNSGDYEILYWDIPNGCKLIRNRSDCKDIDWTTYTCVLGFQVF
GVWPEGSDGTDINALVRSHNRKVIAVADDFCKVHLFQYPCSKAKAPSHKYSAHSSHVTNV
SFTHNDSHLVSTGGKDMSIIQWKLVEKLPLPQNETVADTTLTKTPVSSTESVIQSNTPTP
PPSQPLNETAEEESRISSSPTLLENSLEQTVEPSEDHSEEESAGGSGDLGEPLYEEPSNE
ISKGHNEATLPEDQQDASPLS
NT seq 2946 nt   +upstreamnt  +downstreamnt
atggacggtttcgccggcagcctcgatgatagtatttctgctgcaagtacttctgatgtt
caagatcgcctgtcagctcttgagtcacgagttcagcaacaagaagatgaaatcactgtg
ctaaaggcagcattggctgatgttttgaggcgtcttgcaatctcggaagatcatgtggcc
tcagtgaaaaaatcagtctcaaataaaggccaaccaagccctcgagcagctattcccatg
tcctgtataaccaatggaagtggtgcaaacagaaaaccaagtcaaaccagcgctgtctca
attgcaggaaaagaaactctttcatctgctgctaaaagtggtacagaaaaaaagaaagaa
aaaccacaaggacagagagaaaaaaaagaggaatctcattctaatgatcaaagtccacaa
attcgagcatcaccttctccccagccctcttcacaacctctccaaatacacagacaaact
tcagaaagcaagaatgctactcccaccaaaagcataaaacgaccatcaccagctgaaaag
tcacatcattcatgggaaaattcagatgatagccgtaataaattgtcgaaaatacctcca
acacccaaattaataccaaaagttaccaaaaatgcagacaagcataaagatgtcatcatc
aaccaagagggagaatatattaaaatgtttatgcgaggtcgaccaattaccatgttcatt
ccttctgatgttgacaactatgatgacatcagaacagaactgcctcctgagaagctcaaa
ttggagtgggcatatggttatcgaggaaaggactgtagagctaatgtttaccttcttccg
accggggaaatagtttatttcattgcatcagtagtagtactatttaactatgaggagaga
actcaacgacactacctgggtcatacagactgtgtgaaatgccttgctatacatcctgac
aaaattaggattgcaactggacagatagctggcgtggataaagatggaaggcctctacaa
ccccacgtcagagtgtgggattctgttactctatccacattgcagattattggacttggc
acttttgagcgtggagtgggatgcctggatttttcaaaagcagattcaggtgttcattta
tgtgttattgatgactccaatgagcatatgcttactgtatgggactggcagaaaaaagca
aaaggagcagaaataaagacaacaaatgaagttgttttggctgtggagtttcacccaaca
gatgcaaatactataataacatgcggtaaatctcatattttcttttggacctggagtggc
aattcactaacaagaaaacagggaatttttgggaaatatgaaaagccaaaatttgttcag
tgtttagcattcttgggaaatggagatgtccttactggagactcaggtggagtcatgctt
atatggagcaaaattactgtagaacccacacctgggaaggttcctaaaggtatatatcaa
atcagcaaacaaatcaaagcacatgatggcagtgtgttcacactttgtcagatgagaaat
gggatgttattaactggaggaggaaaagacagaaaaataattctgtgggatcatgatctg
aatcctgaaagagaaatagaggttcctgatcagtatggcacaatcagagctgtagcagaa
ggaaaggcagatcaatttttagtaggcacatcacgaaactttattttacggggaacattt
aatgatggcttccaaatagaagtacaaggtcatacagatgagctttggggtcttgccaca
catcccttcaaagatttgctcttgacatgtgctcaggacaggcaggtctgcctgtggaac
tcagtggaacacaggctggaatggaccaggctggtagatgaaccaggacactgtgcggat
tttcatccaagtggcacagtggtggccataggaacgcactcaggcaggtggtttgttctg
gatgcagaaaccagagatctagtttctatccacacagacgggaatgaacagctctctgta
atgcgctactcagtagatggtaccttcctggctgtaggatctcatgacaactttatttac
ctctatgtagtctcagaaaatggaagaaaatatagcagatatggaaggtgcactggacat
tccagctacatcacacaccttgactggtctccagacaacaagtacataatgtctaactcg
ggagactatgaaatactgtactgggacattccaaatggctgcaaactaatcaggaatcga
tcggattgtaaggacattgattggacgacatatacctgtgtgctaggatttcaagtcttt
ggtgtctggccagaaggatctgatgggacagatatcaatgcactggtgcgatcccacaat
agaaaagtgatagctgttgccgatgacttttgtaaagtccatctgtttcagtatccctgc
tccaaagcaaaggctcccagtcacaagtacagtgcccacagcagccatgtcaccaatgtc
agttttactcacaatgacagtcacctcgtatcaactggtggaaaagacatgagcatcatt
cagtggaaacttgtggaaaagttacctttgcctcagaatgagactgtagcggatactact
ctaaccaaaacccccgtctcttccactgaaagtgtcatccaatctaatactcccacacca
cctccttctcagcccttaaatgagacagctgaagaggaaagtagaataagcagttctccc
acacttctggagaatagcctggaacaaactgtggagccgagtgaagaccacagtgaggag
gagagtgcagggggcagcggagaccttggtgagcctctttatgaagagccatccaacgag
ataagcaaggggcacaacgaagccacccttccagaggaccagcaagatgcttcacccctg
tcctaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044905
Entry
101044905         CDS       T04350                                 

Gene name
ALK
Definition
(RefSeq) ALK tyrosine kinase receptor
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq05200  Pathways in cancer
sbq05223  Non-small cell lung cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101044905 (ALK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101044905 (ALK)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    101044905 (ALK)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101044905 (ALK)
Protein kinases [BR:sbq01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   101044905 (ALK)
CD molecules [BR:sbq04090]
 Proteins
  101044905 (ALK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase MAM Gly_rich Ldl_recept_a Nup96 FXa_inhibition
Other DBs
NCBI-GeneID: 101044905
NCBI-ProteinID: XP_003941568
UniProt: A0A2K6SJW7
LinkDB
Position
Unknown
AA seq 1621 aa
MGPIGLLWLLPLLLSTAALGSGTGAGQRLGSPAAGLQLQPREPLSYSRLQRKSLAVDFVV
PSLFRVYARDLLLPSSPSELKAERPEARGSLALDCAPLLRLLGPPPGVSWTMGSPAPAEA
RTLSRVLKGGSVRKLRRAKQLVLELGEEAILEGCVGSPGEAAAGLLQFNLSELFSWWIRQ
GEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIFGTGHSSLESPRNMPSPSPDH
FTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRVPSEEASQ
MDFLDGPEAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVHRHLQPSGR
YVAQLLPHNEAAREILLMPTPGKHGWTVLQGRIGRPDSPFRVALEYISSGNRSLSAVDFF
ALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQDCAQGEDESHMCRKLPAGFYC
NFEDGFCGWTQGTLSPHTPQWQIRTLKDARFQDHQDHALLLSTTDVATSESATVTSATFP
APMKSSPCELRMSWLIRGVLRGNVSLVLVENKTGKEHGRMVWHVAAYEGLSLWQWTVLPL
LDVSDRFWLQMVAWWGQGSRAIVAFDNISISLDCYLTISGEDKIPQKTAPKSRNLFERNP
NKELKPGENSARQNPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVEVGSEGPL
KGIQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDTLYILVGQQGE
DACPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLII
AAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLLEGA
TGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFIS
PLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHGTVLAEDGVS
CIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKL
SKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPS
DPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALPRFILLELMA
GGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCP
GPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLW
EIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIIL
ERIEYCTQDPDVINTALPIEYGPLVEEEEKVPVRPKDPEGVPPLLVSHQVKRGEEERGPA
APPPLPTTSSGKATKKPTAAEVSVRVPRGPTVEGGHVNMAFSQSNPPSELHKVQGSRNKP
TSLWNPTYGSWFTEKPTKKNNPLAKKEPHERGNLGLEGSCTVPPNVATGRLPGASLLLEP
SSLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYEDTLLKSKNSMNQPG
P
NT seq 4866 nt   +upstreamnt  +downstreamnt
atgggacccatcgggctcttgtggctactgccgctgctgctttccacggcagctttgggg
tccgggacaggggccggccagcgcttggggtccccagctgcggggctgcagttgcagccc
cgggagccgctcagctactcgcgcctgcagaggaagagtctggcagtggacttcgtggtg
ccctcgctcttccgtgtctacgcccgggacctgctgctgccgtcatccccctcggaactg
aaggctgaaaggcccgaggcgcgaggctcgctagcgctggactgcgccccgctgctcagg
ctgttggggccaccccctggggtctcgtggaccatgggctcacccgccccggcagaggcc
cggacactgtccagggtgctgaagggcggctccgtgcgcaagctccggcgcgccaagcag
ctggtgttggagcttggcgaggaggcgatcctggagggttgcgttgggtccccgggggag
gcagctgcggggctgctccagttcaacctcagcgagctgttcagttggtggattcgccag
ggcgaagggcgactgagaatccggctgatgcccgagaagaaggcttcggaagtgggcaga
gagggaaggctgtccgcggcaatccgcgcctcccagccccgccttctcttccagatcttc
gggactggtcatagctccttggagtcaccaagaaatatgccttctccttctcctgatcat
tttacatggaatctcacctggataatgaaagactccttccctttcctgtctcatcgcagc
agatatggtctggagtgcagctttgacttcccctgtgagctggaatattcccctccactg
catgacctcaggaaccagagctggtcctggcgccgcgtcccctctgaggaggcctcccag
atggactttctggacggccctgaggcagagcgttctaaggagatgcccagaggctccttc
ctcctcctcaacacctctgctgactccaagcacaccatcctgagtccatggatgaggagc
agcagcgagcactgcacgctggccgtgtcggtgcacagacacctgcagccctctggaagg
tacgtcgcccagctgcttccccacaacgaggctgcaagagagatcctcctgatgcccacc
ccagggaagcacggttggacagtgctccagggaagaattgggcgcccagacagcccgttt
cgagtggccctggaatacatctccagtggaaaccgcagcttgtctgcagtggacttcttt
gccctgaagaactgcagtgaaggaacatcccccggctccaagatggccctgcagagctcc
ttcacttgttggaacgggacagtcctccagcttggccaggcctgtgacttccaccaggac
tgcgcccagggagaagacgagagccacatgtgccgtaaactccctgcgggtttttactgc
aactttgaagatggcttctgtggctggacccaaggcaccctctcaccccacactcctcag
tggcagatcagaactctaaaggatgccaggttccaggaccaccaagaccatgcactattg
ctcagtaccactgatgtcgccacttctgaaagcgctacagtgaccagtgctacgtttccc
gcaccgatgaagagctctccatgtgagctccgaatgtcctggctcattcgtggagtcttg
aggggaaacgtgtccttggtgctagtggagaacaaaaccgggaaggagcatggcaggatg
gtctggcatgtcgctgcctatgaaggcctgagcttgtggcaatggacggtgttgccactc
ctcgacgtgtctgacaggttctggctgcagatggtcgcatggtggggacaaggatccaga
gccatcgtggcttttgacaatatctccatcagcctggactgctacctcaccattagtgga
gaggacaagatcccacagaagacagcacccaaatcaagaaacctgtttgagagaaaccca
aacaaggagctgaaacctggggaaaattcagcaagacagaaccccatctttgaccctaca
gttcattggctgttcaccacgtgtggggccagcgggccccacggccccacccaagcccaa
tgcaacaacgcctaccagaactccaacctgagcgtggaggtgggaagcgagggccccctg
aagggcatccagatctggaaggtgccagccaccgacacctacagcatctcaggctacgga
gctgctggcgggaagggcgggaagaacaccatgatgcggtcccacggcgtgtctgtgctg
ggcatcttcaacctggaaaaggatgacacgctatacatcctggtcgggcagcagggggag
gacgcctgccccagtacaaaccagttaatccagaaagtctgcattggcgagaacaatgtg
atcgaagaagaaattcgtgtgaacagaagtgtgcatgagtgggcaggaggaggaggaggc
gggggcggagccacctacgtatttaagatgaaggatggagtgccggtgcccctgatcatt
gcagctggaggtggcggcagggcctacggggccaagacagacacgttccacccagagaga
ctggagaataactcctccgttctaggcctgaacggcaattccggagccgcaggtggtgga
ggtggctggaatgataacacttccttgctctgggccggaaaatctttgttggagggcgcc
accggaggacattcctgcccccaggccatgaagaagtgggggtgggagacaagagggggt
ttcggagggggtggaggggggtgctcctcaggtggaggaggcggaggatatataggcggc
aatgcagcctcaaacaatgaccccgaaatggatggggaagatggggtttccttcatcagt
ccactgggcatcctgtacaccccagctttaaaagtgatggaaggccacggggaagtgaat
attaagcattatctaaactgcagtcactgtgaggtagacgaatgtcacatggaccccgaa
agccacaaggtcatctgcttctgtgaccatgggacggtgctggcagaggatggtgtctcc
tgcattgtgtcgcccaccccggagccacacctgccactctcgctgattctgtctgtggtg
acctctgccctcgtggccgccctcgtcctggctttttctggcatcatgatcgtgtaccgc
cggaagcaccaggagctgcaagccatgcagatggagctgcagagccctgagtacaagctg
agcaagctccgtacctcgaccatcatgacagactacaaccccaactactgctttgctggc
aagacctcctccatcagtgacctgaaggaggtgccacggaagaacatcaccctcattcgg
ggtctgggccatggcgcctttggggaggtgtatgaaggccaggtgtctggaatgcccagt
gacccaagtcccctgcaagtggctgtaaagacgctgcctgaggtgtgctcagaacaggac
gaactggatttcctcatggaagccctgattatcagcaaattcaaccaccagaacattgtt
cgctgcatcggggtgagcctgcaagcccttccccggttcatcctgctagagctcatggcc
gggggagacctcaagtccttcctccgagagacccgccctcgcccgagccagccctcctcc
ctggccatgctggaccttttgcatgtggctcgggacattgcctgtggctgccagtatttg
gaggaaaaccacttcatccaccgagacattgctgccaggaactgcctcttgacctgtcca
ggccctggaagagtggccaagattggggactttgggatggcccgagacatctaccgggcg
agctactacagaaagggaggctgtgcaatgctgccagttaagtggatgcccccagaggcc
ttcatggaaggaatattcacttctaaaacagacacatggtccttcggagtgctcctgtgg
gaaatattttctctgggatatatgccataccccagcaaaagcaaccaggaagttctggag
ttcgtcaccagtggaggccggatggacccacctaagaactgccctgggcctgtataccgg
ataatgactcagtgctggcaacatcagcctgaagacaggcccaacttcgccatcattttg
gagaggattgaatactgcacccaggacccagatgtaatcaacaccgctttgccgatagaa
tacgggccacttgtggaagaggaagagaaagtgcccgtgcggcccaaggaccctgagggg
gttcctcctctcctggtctcccaccaggtgaaacgcggggaggaggagcgcggcccagct
gccccaccaccgctgcctaccacctcctctggcaaggccacaaagaaacccacagctgca
gaggtctctgttcgagtccctagagggccaaccgtggaagggggacacgttaacatggcg
ttctctcagtccaaccccccttcagagttgcacaaggtccagggatccagaaacaagccc
accagcctgtggaacccaacgtacggctcctggtttacagagaaacccaccaaaaagaac
aatcctctagcaaagaaggagccacatgagaggggtaacctggggctcgagggaagctgt
actgttccacctaacgttgcaactgggagacttccaggggcctctctgctcctagagccc
tcttcgctgactgccaatatgaaggaggtacctctgttcaggctacgtcacttcccttgt
gggaatgtcaattacggctaccagcaacagggcttgcccttagaggctgctactgcccct
ggagctggccactatgaggacacccttctgaagagcaagaatagcatgaaccagcctggg
ccctga

DBGET integrated database retrieval system