KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039593
Entry
101039593         CDS       T04350                                 

Gene name
SMAD3
Definition
(RefSeq) mothers against decapentaplegic homolog 3 isoform X1
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04068  FoxO signaling pathway
sbq04110  Cell cycle
sbq04144  Endocytosis
sbq04218  Cellular senescence
sbq04310  Wnt signaling pathway
sbq04350  TGF-beta signaling pathway
sbq04371  Apelin signaling pathway
sbq04390  Hippo signaling pathway
sbq04520  Adherens junction
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04659  Th17 cell differentiation
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq05161  Hepatitis B
sbq05166  Human T-cell leukemia virus 1 infection
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05220  Chronic myeloid leukemia
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101039593 (SMAD3)
   04350 TGF-beta signaling pathway
    101039593 (SMAD3)
   04390 Hippo signaling pathway
    101039593 (SMAD3)
   04371 Apelin signaling pathway
    101039593 (SMAD3)
   04068 FoxO signaling pathway
    101039593 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101039593 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    101039593 (SMAD3)
   04218 Cellular senescence
    101039593 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101039593 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101039593 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101039593 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101039593 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101039593 (SMAD3)
   05212 Pancreatic cancer
    101039593 (SMAD3)
   05225 Hepatocellular carcinoma
    101039593 (SMAD3)
   05226 Gastric cancer
    101039593 (SMAD3)
   05220 Chronic myeloid leukemia
    101039593 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101039593 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101039593 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101039593 (SMAD3)
   05161 Hepatitis B
    101039593 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 101039593
NCBI-ProteinID: XP_003929748
UniProt: A0A2K6SKP9
LinkDB
Position
Unknown
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHSNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgtccattctgcctttcactcccccgatcgtgaagcgcctgctgggctggaagaag
ggcgagcagaacgggcaggaggagaaatggtgcgagaaggcggtcaagagcctggtcaag
aagctcaagaagacggggcagctggacgagctggagaaggccatcaccacgcagaacgtc
aacaccaagtgcatcaccatccccaggtccctggatggccggttgcaggtgtcccatcgg
aaagggctccctcatgtcatctactgccgcctgtggcgatggcccgacctgcacagccac
cacgagctgcgggccatggagctgtgtgagttcgccttcaatatgaagaaggacgaggtc
tgcgtgaatccctaccactaccagagagtagagacaccagttctgcctcctgtgttggtc
ccacgccacacagagatcccggccgagttccccccactggacgactacagccattccatc
cccgaaaacactaacttccccgcaggcatcgagccccagagcaatattccagagacccca
ccccctggctacctgagtgaagatggagaaacgagtgaccaccagatgaaccacagcatg
gacgcaggttctccaaacctatccccgaatccgatgtccccagcacacagtaacttggac
ctgcagccagtcacctactgtgagccagccttctggtgctccatctcctactacgagctg
aaccagcgcgtcggggagacgttccacgcctcgcagccatccatgactgtggacggcttc
accgacccctccaactccgagcgcttctgcctagggctgctctctaacgtcaacaggaac
gcagcggtggagctgacgcgaaggcacatcggaagaggcgtgcggctctactacatcgga
ggggaggtcttcgcagagtgcctcagtgacagcgccatctttgtccagtctcccaactgt
aaccagcgctatggctggcacccagccaccgtctgcaagatcccaccaggatgcaacctg
aagatcttcaacaaccaggagttcgctgccctcctggcccagtccgtcaaccagggcttc
gaggctgtctaccagttgacccgaatgtgcaccatccgcatgagcttcgtcaaaggctgg
ggagcagagtacaggagacagactgtgaccagtaccccctgctggatcgagctgcacctg
aatgggcctttgcagtggcttgacaaggtcctcacccagatgggctccccaagcatccgc
tgttccagtgtgtcttaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040653
Entry
101040653         CDS       T04350                                 

Gene name
SMAD2
Definition
(RefSeq) mothers against decapentaplegic homolog 2
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04110  Cell cycle
sbq04144  Endocytosis
sbq04218  Cellular senescence
sbq04350  TGF-beta signaling pathway
sbq04371  Apelin signaling pathway
sbq04390  Hippo signaling pathway
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04659  Th17 cell differentiation
sbq04926  Relaxin signaling pathway
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq05142  Chagas disease
sbq05166  Human T-cell leukemia virus 1 infection
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101040653 (SMAD2)
   04390 Hippo signaling pathway
    101040653 (SMAD2)
   04371 Apelin signaling pathway
    101040653 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101040653 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    101040653 (SMAD2)
   04218 Cellular senescence
    101040653 (SMAD2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101040653 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101040653 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101040653 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101040653 (SMAD2)
   05205 Proteoglycans in cancer
    101040653 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101040653 (SMAD2)
   05212 Pancreatic cancer
    101040653 (SMAD2)
   05225 Hepatocellular carcinoma
    101040653 (SMAD2)
   05226 Gastric cancer
    101040653 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101040653 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101040653 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101040653 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101040653 (SMAD2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 101040653
NCBI-ProteinID: XP_003926132
UniProt: A0A2K6V827
LinkDB
Position
Unknown
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcacgccgccagttgtgaagagactgctgggatggaagaag
tcagctggtgggtctggaggagcaggcggaggagagcagaatgggcaggaagaaaagtgg
tgtgagaaagcagtgaaaagtctggtgaagaagctgaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaactgtaatactaaatgtgttaccataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtctcttgatggtcgtctccaggtatcccatcga
aaaggattgccacatgttatatattgccgattatggcgctggcctgatcttcacagtcat
catgaactcaaagcaattgaaaactgcgaatatgcttttaatcttaaaaaggatgaagta
tgtgtaaacccttaccactatcagagagttgagacaccagttttgcctccagtattagtg
ccccgacacactgagatcctaacagaacttccgcctctggatgactatactcactccatt
ccagaaaacactaacttcccagcaggaattgagccacagagtaattatattccagaaacg
ccacctcctggatatatcagtgaagatggagaaacaagtgaccaacagttgaatcaaagt
atggacacaggctctccagcagaactgtctcctactactctttcccctgttaatcatagc
ttggatttacagccagttacttactcagaacctgcattttggtgttcaatagcgtattac
gaattaaatcagagggttggagaaaccttccatgcatcacagccctcactcactgtagat
ggctttacagacccatcaaattcagagaggttctgcttaggtttactctccaatgttaac
cgaaatgccacagtagaaatgacaagaaggcacataggaagaggagtgcgcttatattac
ataggtggggaagtttttgctgagtgcctaagtgatagtgcaatctttgtgcagagcccc
aattgtaatcagagatatggctggcaccctgcaacagtgtgtaaaattccaccaggctgt
aatctgaagatcttcaacaaccaggaatttgctgctcttctggctcagtctgttaatcag
ggttttgaagccgtctatcagctaactagaatgtgcaccataagaatgagttttgtgaaa
gggtggggagcagaataccgaaggcagacggtaacaagtactccttgctggattgaactt
catctgaatggacctcttcagtggttggacaaagtattaactcagatgggatccccttca
gtgcgttgctcaagcatgtcataa

DBGET integrated database retrieval system