KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039649
Entry
101039649         CDS       T04350                                 

Gene name
MSH6
Definition
(RefSeq) DNA mismatch repair protein Msh6
  KO
K08737  DNA mismatch repair protein MSH6
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01524  Platinum drug resistance
sbq03430  Mismatch repair
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    101039649 (MSH6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101039649 (MSH6)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101039649 (MSH6)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101039649 (MSH6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sbq03400]
    101039649 (MSH6)
DNA repair and recombination proteins [BR:sbq03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     101039649 (MSH6)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I PWWP MutS_IV MutS_II UPF0524
Other DBs
NCBI-GeneID: 101039649
NCBI-ProteinID: XP_003922807
UniProt: A0A2K6S4G8
LinkDB
Position
Unknown
AA seq 1358 aa
MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAATRASPPGEDAAWSEAGPGPRPLA
RSASPPKAKNLNGGLRRSAATAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIR
EKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADE
ALNKDKIKRLELAVCDEPSEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRRS
SRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKRK
RMVTGNGSLKRKSSRKEAPSATKRAIGISSETKNTLSAFSAPQNSESQAHVSGGGDDSSR
PPVWYHETLEWLKEEKRRDEHRRRPDHPDFDGSTLYVPEDFLNSCTPGMRKWWQIKSQNF
DLVICYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVA
RVEQTETPEMMEARCRKMAHISKYDRVVRREICRIITKGTQTYSVLEGDPSENYSKYLLS
LKEKEEDSSGHIRAYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNL
SKETKTILKSSLSSSLQEGLIPGSQFWDASKTLRTLLEEGYFREKLSDDIGVMLPQVLKG
MTSESDSIGLTPGERSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDTVSTTR
SGAVFTKAYQRMVLDAVTLNNLEIFLNGTNGSAEGTLLERVDTCHTPFGKRLLKQWLCAP
LCSPYAINDRLDAIEDLMAVPDKISEVVELLKKLPDLERLLSKIHNVGSPLKSQNHPDSR
AIMYEETTYSKKKIIDFLSALEGFKVMCKIIGIMEEVVDGFKSKILKQVISLQTKNPEGR
FPDLTVELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRNR
IGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINA
EERRDVSLKDCMRRLFYNFDKNYKDWQSAVECIAVLDVLLCLADYSRGGDGPMCRPVILL
PEDTAPFLELKGSRHPCITKTFFGDDFIPNDILIGCEEEEENGKAYCVLVTGPNMGGKST
LMRQAGLLVVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILS
HATAHSLVLVDELGRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSQNVAV
RLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKARE
FEKMNQSLRLFREVCLASERSTVDAEAVHKLLTLIKEL
NT seq 4077 nt   +upstreamnt  +downstreamnt
atgtcgcgacagagcaccctgtacagcttcttccccaagtctccggcgctgagtgatgcc
aacaaggcctcggccagggcctcacgcgaaggcggccgcgccgccgctgccacccgggcc
tctcctccaggagaggatgcggcctggagcgaggcagggcctgggcccaggcccctggcg
cgctccgcgtcaccgcccaaggcgaagaacctcaacggaggtttgcggagatccgcagcg
actgcggcccccaccagttgtgacttctcaccaggagatttggtttgggccaagatggag
ggttacccctggtggccttgtctggtttacaaccacccctttgatggaacattcatccgc
gagaaagggaaatcagttcgtgttcatgtacagttttttgatgatagcccaacaaggggc
tgggttagcaaaaggctcttaaagccatatacaggttcaaaatcaaaggaagcccagaag
ggaggccatttttacagtgcaaagcctgaaatactgagagcaatgcaacgtgcagatgaa
gccttaaataaagacaagattaagagacttgaattggcggtttgtgatgagccctcagag
ccagaagaggaagaagagatggaggtaggcacaacttacgtaacagataagagtgaggaa
gataacgaaattgagagtgaagaggaagtacagcctaagacacaaggatctaggcgaagt
agtcgccaaataaaaaaacgaagggtcatatcagactctgagagtgacatcggtggctct
gatgtggaatttaagccagacactaaagaggaaggaagcagtgatgaaataagcagtggg
gtaggggatagtgagagtgaaggcttgaacagccctgtcaaagttgctcgaaagcggaag
agaatggtgactggaaatggctctcttaaaagaaaaagctctaggaaggaagctccttca
gccaccaaacgagcaattggcatttcatcagaaaccaagaatactttgagtgctttctct
gcccctcagaattctgaatcccaagcccacgttagtggaggtggtgatgatagtagtcgc
cctcctgtttggtatcatgaaactttagaatggctaaaggaggaaaagagaagagatgaa
cataggaggcggcctgatcaccccgattttgatggatccacactctatgtgcctgaggat
tttcttaattcttgtactcctgggatgaggaagtggtggcagattaagtctcagaacttt
gatcttgtcatctgttacaaagtggggaaattttatgaactgtaccacatggatgctctt
attggagtcagtgaactggggctagtatttatgaaaggcaactgggcccattctggtttt
cctgaaattgcatttggccgttattcagattccctggtgcagaagggctataaagtagca
cgagtggaacagacggagactccggaaatgatggaggcacgatgccgaaagatggcacat
atatccaagtatgatagagtggtgaggagggagatctgtaggatcattaccaagggtacg
cagacctacagtgtgctggaaggtgatccttctgagaactacagtaaatatcttcttagc
ctcaaagaaaaagaggaagattcttctggccatattcgtgcatatggtgtatgctttgtt
gatacttcactagggaagtttttcataggtcagttttcagacgatcgccattgttcgaga
tttaggactctagtggcacactatcccccagtacaagtcttatttgagaaaggaaatctc
tcaaaagaaactaaaacaattctaaagagttcattgtcctcttctcttcaggaaggtctg
ataccaggctcccagttctgggatgcatccaaaactttgagaactctccttgaggaagga
tattttagggaaaaactaagtgatgacattggggtgatgttgccccaggtgcttaaaggt
atgacttcagagtctgattccattgggttgacaccaggagagagaagtgaattggccctc
tctgctctgggtggttgtgtcttctacctcaaaaaatgccttattgatcaggagctctta
tcaatggctaattttgaagaatatattcccttggattctgacacagtaagcactacgaga
tctggtgctgtcttcaccaaagcatatcaacgaatggtgctagatgcagtgacattaaat
aacttggagatttttctgaatggaacaaatggttctgctgaaggaaccctgctggagagg
gttgatacttgccatactccctttggtaagcggctcctaaagcaatggctttgtgcccca
ctctgtagcccttatgctatcaatgatcgtcttgatgccatagaagacctcatggctgta
cctgacaaaatctccgaagttgtagagcttctaaagaagcttccagatcttgagagacta
ctcagtaaaattcataatgttgggtctcccctgaagagtcagaaccacccagatagcagg
gctataatgtatgaagaaactacatacagcaaaaaaaagattattgattttctttctgct
ctggaaggattcaaagtaatgtgtaaaattatagggatcatggaagaagttgttgatggt
tttaagtctaaaatccttaagcaggtcatctctctgcagacaaaaaatcctgaaggccgt
tttcctgatttgactgtagaattgaacagatgggatacagcctttgaccatgaaaaggct
cggaagactggacttattactcccaaagcaggctttgactctgattatgaccaagctctt
gctgacataagagaaaatgaacagagcctcctggaatacttagagaaacagcgcaacaga
attggctgtaggaccatagtctattgggggattggtaggaaccgttaccagttggaaatt
cctgagaattttaccactcgcaatttgccagaagaatatgaattgaaatctaccaagaag
ggctgtaaacgatactggaccaaaactattgagaagaagttggctaatctcataaatgct
gaagaacggagagatgtatcattgaaggactgcatgcggcgactgttctataactttgat
aaaaattacaaggactggcagtctgctgtagagtgtattgcggtgttggatgtcttactg
tgcctggctgactatagtcgagggggtgatggtccaatgtgtcgcccagtaattctgttg
ccagaagataccgcccccttcttagagcttaaaggatcacgccatccttgtattacgaag
actttttttggagatgattttattcctaatgacattctaataggctgtgaagaggaggag
gaaaatggcaaagcctattgtgtgctagttactggaccaaatatggggggcaagtctacg
ctcatgagacaggctggcttattagttgtaatggcccagatgggttgttacgtccctgct
gaagtgtgcaggctcacaccaattgacagagtgtttaccagacttggtgcctcagataga
ataatgtcaggtgaaagtacattttttgttgaattaagtgaaactgccagcatactctca
catgcaacagcacattctctggtgcttgtggatgaattaggaagaggtacggcaacattt
gatgggacagcaatagcaaatgcagttgttaaagaacttgctgagactataaaatgtcgt
acattgttttcaactcactaccattcattagtagaagattattctcaaaacgttgctgtg
cgcctaggacacatggcatgcatggtagaaaatgaatgtgaagacccaagccaggagact
attactttcctctataaattcattaagggagcttgtcctaaaagctatggctttaatgca
gcaaggcttgccaatctcccagaggaagttattcaaaagggacatagaaaagcaagagaa
tttgagaagatgaatcagtcactacgattatttcgggaagtttgcctggctagtgaaagg
tcaactgtagatgctgaagctgtccataaattgctgactttgattaaggaattatag

DBGET integrated database retrieval system