KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039763
Entry
101039763         CDS       T04350                                 

Gene name
IGF1R
Definition
(RefSeq) insulin-like growth factor 1 receptor isoform X1
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04114  Oocyte meiosis
sbq04140  Autophagy - animal
sbq04144  Endocytosis
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04510  Focal adhesion
sbq04520  Adherens junction
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04730  Long-term depression
sbq04913  Ovarian steroidogenesis
sbq04914  Progesterone-mediated oocyte maturation
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05205  Proteoglycans in cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101039763 (IGF1R)
   04014 Ras signaling pathway
    101039763 (IGF1R)
   04015 Rap1 signaling pathway
    101039763 (IGF1R)
   04066 HIF-1 signaling pathway
    101039763 (IGF1R)
   04068 FoxO signaling pathway
    101039763 (IGF1R)
   04151 PI3K-Akt signaling pathway
    101039763 (IGF1R)
   04152 AMPK signaling pathway
    101039763 (IGF1R)
   04150 mTOR signaling pathway
    101039763 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101039763 (IGF1R)
   04140 Autophagy - animal
    101039763 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101039763 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101039763 (IGF1R)
   04520 Adherens junction
    101039763 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    101039763 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    101039763 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    101039763 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    101039763 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    101039763 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    101039763 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101039763 (IGF1R)
   05202 Transcriptional misregulation in cancer
    101039763 (IGF1R)
   05205 Proteoglycans in cancer
    101039763 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101039763 (IGF1R)
   05214 Glioma
    101039763 (IGF1R)
   05218 Melanoma
    101039763 (IGF1R)
   05215 Prostate cancer
    101039763 (IGF1R)
   05224 Breast cancer
    101039763 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101039763 (IGF1R)
   01522 Endocrine resistance
    101039763 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101039763 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:sbq04090]
    101039763 (IGF1R)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101039763 (IGF1R)
Protein kinases [BR:sbq01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   101039763 (IGF1R)
CD molecules [BR:sbq04090]
 Proteins
  101039763 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD DUF4476
Other DBs
NCBI-GeneID: 101039763
NCBI-ProteinID: XP_003940579
UniProt: A0A2K6SSM8
LinkDB
Position
Unknown
AA seq 1366 aa
MKSSSGGGSPTSLWGLLFLSTVLVLWPTSGEICGPGIDIRNDFHQLRRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVVGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTSLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
VCPGAMEENPMCEKTAINNEYNFRCWTTNRCQKMCPSACGKRACTDNNECCHPECLGSCS
APDNDTACVACLHYYHAGICVPACPPNTYRFEGWRCVDRQFCASIVSSENSENNKFVIHD
GECMQDCPSGFIRDTTHSMQCIPCKGPCPKVCDEQMAKSIDSVTSAQMLQGCTIFKGNLL
INIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEDQLEGNYSFY
VLDNQNLQQLWDWDHQNLTIRSGKMYFAFNPKLCVSEIYRMEEVTGTKGRQNKGDINTRN
NGERASCESDVLHFTSTTTWKNRVIITWHRYRPPDYRDLISFTVFYKEAPFKNVTEYDGQ
DACGSNSWNMVDVDLPQNKDVEPGVLLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEI
LYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQQQPQDSYLYRHN
YCSKDKIPIRKYAGGSIDVEEVTENPKTEACGTEKGPCCACPKTEAEKQAEKEEAEYRKV
FENFLHNSIFVPRPDRKRRDVIQVANSSTSSRSRNTTAVDTYNITDLDELETEYPFFESR
VDNRERTVISNLRPFTLYRIDIHSCNHEAERLGCSASNFVFARTMPADGADDIPGPVTWE
PRPENSIFLKWPEPENPNGLILMYEIKYGAQVEDQRECVSRQDYRKYGGAKLNRLNPGNY
TARIQATSLSGNGSWTEPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHRK
RSSSRLGNGVLYASVNPEYFSAADVYIPDEWEVAREKITMSRELGQGSFGMVYEGVAKGV
VKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMEL
MTRGDLKSYLRSLRPETENNPVLAPPSLSKMIQMSGEIADGMAYLNANKFVHRDLAARNC
MVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVV
LWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMGMCWQYNPKMRPSFLE
IISSIKDEMEPGFREVSFYYSEENKPPESEELDLEPENMESVPLDPSASSASLPLPDRRS
GHKAENSPSPGVLVLRASFDERQPFAHMNGGRKNERALPLPQSSTC
NT seq 4101 nt   +upstreamnt  +downstreamnt
atgaagtctagttccggaggagggtccccgacctcgctctgggggctgctgtttctctcc
accgtgctcgtgctctggccgacgagtggagaaatctgtgggccgggcatcgacatccgc
aatgatttccatcagctgaggcgcctggagaactgcacggtgatcgagggttacctgcac
atcctgctcatctccaaggccgaggactaccgcagctaccgcttccctaagctcacggtc
atcaccgagtacttgctgctgttccgagtggttggcctcgagagcctcggagacctcttc
cccaacctcacggtcatccgcggctggaaactcttctacaactacgccctggtcatcttc
gagatgaccagtctcaaggatattgggctttacaacctgaggaacattactcggggggcc
atcaggattgagaaaaatgctgacctctgttatctctccactgtggactggtccctgatc
ctggatgcagtgtccaataactacattgtggggaataagcccccaaaggaatgtggagac
gtgtgtccaggggccatggaggagaacccaatgtgcgagaagaccgccatcaacaacgag
tacaacttccgctgctggaccacaaaccgctgccagaaaatgtgtccgagtgcgtgtggg
aagcgggcgtgcaccgacaacaacgagtgctgtcaccccgagtgcctgggcagctgcagc
gcgcctgacaacgacacggcctgtgtggcttgcctccactactaccatgccggtatctgc
gtgcccgcctgcccgcccaacacctacaggtttgagggctggcgctgtgtggaccgtcag
ttctgtgccagcatcgtcagctccgagaactcggagaacaacaagtttgtgatccatgac
ggcgagtgcatgcaggactgcccctcgggcttcatccgcgacaccacccacagcatgcag
tgcatcccttgtaaaggtccttgccccaaggtctgtgatgaacagatggcaaagtccatt
gattccgttacttctgctcagatgcttcaaggatgcaccatcttcaagggcaatttgctc
attaacatccgacgagggaataacattgcttcagaactggagaacttcatggggctcatc
gaggtggtgacgggctacgtgaagatccgccattcccatgccttggtctccttgtccttc
ctaaaaaaccttcgcctcatcttaggagaggaccagctagaagggaattactccttctat
gtcctcgacaaccagaatttgcagcagctatgggactgggaccaccagaacctgaccatc
cgttcggggaagatgtactttgctttcaatcccaaactgtgtgtttccgaaatttaccgc
atggaagaagtgacggggactaaagggcgccaaaacaaaggggacataaacaccaggaac
aatggagagagagcctcctgtgaaagtgacgtcctgcatttcacctccaccaccacgtgg
aagaatcgcgtcatcataacctggcaccggtaccggccccccgactacagggatctcatc
agtttcaccgtcttctacaaggaagcaccctttaagaatgtcacagagtatgatgggcag
gacgcctgtggctccaacagctggaacatggtggacgtggacctcccccagaacaaggac
gtggagcctggtgtcttactgcatgggctgaagccgtggactcagtacgctgtttatgtc
aaggccgtaaccctcaccatggtggagaacgaccatatccgtggggccaagagtgagatc
ttgtacattcgcaccaatgcttcagttccttccattcccttggacgtgctttcagcatca
aactcctcttctcagttaattgtgaagtggaaccctccctctctgcccaacggcaacctg
agttactacatcgtgcgctggcagcagcagcctcaggacagctacctttaccggcacaat
tactgctccaaagacaaaatccccattaggaagtacgctggcggctccatcgacgttgag
gaggtcacagagaaccccaagactgaggcgtgtggcacagagaaagggccttgctgcgcc
tgccccaaaaccgaagctgagaagcaggcggagaaggaggaggccgagtaccgcaaggtc
tttgagaatttcctgcacaactccatctttgtgcccagacctgacaggaagcggagagat
gtcatccaggtagccaacagcagcacgtccagccgaagcaggaacaccacggccgttgac
acctacaacatcacagacctggacgagctcgagacggaataccctttctttgagagcaga
gtggataacagggagagaactgtcatttctaaccttcggcctttcacactgtaccgcatt
gacatccacagctgcaaccatgaggctgagaggctgggttgcagtgcttccaactttgtc
tttgcaaggactatgcctgcagacggagcagatgatattcctgggccagtgacctgggag
ccaaggcctgaaaactccatctttttaaagtggccagaacctgagaatcccaatggattg
atcctaatgtatgaaataaagtacggagcacaagtcgaggatcagcgagaatgtgtgtcc
agacaggactacaggaagtatggaggggccaagctaaaccggctaaacccagggaactac
acagcccggattcaggccacatctctctctgggaatgggtcgtggacggagcctgtgttc
ttctatgtccaggccaaaacgggatatgaaaacttcatccatctgatcatcgctcttccc
gttgccgtcctgttgatcgtgggagggttggtgattatgctgtatgtcttccatagaaag
agaagtagcagcaggctggggaatggagtcctgtatgcctctgtgaacccggagtacttc
agcgctgcggatgtgtacattcctgatgagtgggaggtggctcgggagaagatcaccatg
agccgggagcttgggcaggggtcgtttgggatggtctatgaaggagttgccaagggtgtg
gtgaaagatgaacctgaaaccagagtggccattaaaacggtgaacgaggccgcaagcatg
cgcgagaggatcgagtttctcaacgaggcttctgtgatgaaggagttcaattgtcaccat
gtggtgcggttgctgggtgtggtgtcccagggccagccaacactggtcatcatggaactg
atgacacggggcgatctcaagagttatctccggtctctgaggccagaaacggagaataat
ccagtcttagcacctccaagcctaagcaagatgattcagatgtctggagagattgcagac
ggcatggcatacctcaacgccaacaagttcgtccacagagacctggccgcccggaattgc
atggttgccgaagatttcacggtcaaaattggagattttggtatgacacgagatatctat
gagacagactattaccggaaaggagggaaggggctgctgcctgtgcgctggatgtctccc
gagtccctcaaggatggagtcttcaccactcactcggacgtctggtccttcggggttgtg
ctctgggagattgccacgctggccgagcagccgtaccagggcttgtccaatgagcaagtc
cttcgcttcgtgatggagggcggccttctggacaaaccagacaactgccccgacatgctg
tttgaactgatgggtatgtgctggcagtacaaccccaagatgaggccttccttcctggag
atcatcagcagcatcaaagatgagatggagcctggctttcgggaggtctccttctactac
agcgaggagaacaagccacccgagtcagaagagctagacctggagccggagaacatggag
agtgtccctctggacccctcagcctcctcggcctccctgccactgcccgacagacgctcc
gggcacaaggctgagaacagccccagtcctggagtgcttgtcctccgcgccagcttcgac
gagaggcagcctttcgcacacatgaacgggggccgcaagaacgagcgggccttgccactg
ccccagtcttcgacctgctga

DBGET integrated database retrieval system