KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039964
Entry
101039964         CDS       T04350                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04110  Cell cycle
sbq04213  Longevity regulating pathway - multiple species
sbq04330  Notch signaling pathway
sbq04613  Neutrophil extracellular trap formation
sbq04919  Thyroid hormone signaling pathway
sbq05016  Huntington disease
sbq05031  Amphetamine addiction
sbq05034  Alcoholism
sbq05165  Human papillomavirus infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05203  Viral carcinogenesis
sbq05206  MicroRNAs in cancer
sbq05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101039964 (HDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101039964 (HDAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101039964 (HDAC1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101039964 (HDAC1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    101039964 (HDAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101039964 (HDAC1)
   05202 Transcriptional misregulation in cancer
    101039964 (HDAC1)
   05206 MicroRNAs in cancer
    101039964 (HDAC1)
   05203 Viral carcinogenesis
    101039964 (HDAC1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101039964 (HDAC1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101039964 (HDAC1)
  09165 Substance dependence
   05031 Amphetamine addiction
    101039964 (HDAC1)
   05034 Alcoholism
    101039964 (HDAC1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101039964 (HDAC1)
   05165 Human papillomavirus infection
    101039964 (HDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sbq03036]
    101039964 (HDAC1)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101039964 (HDAC1)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     101039964 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     101039964 (HDAC1)
    BRAF-HDAC complex
     101039964 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101039964 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    101039964 (HDAC1)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 101039964
NCBI-ProteinID: XP_010346435
UniProt: A0A2K6TER5
LinkDB
Position
Unknown
AA seq 482 aa
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSLRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKEPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcgcagacgcagggcacccggaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcataat
ttgctgctcaactatggtctctaccgaaaaatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccacagcgatgactacattaaattcttgcgctccctccgt
ccggataacatgtccgagtacagcaagcagatgcagagattcaacgttggtgaggactgt
ccagtattcgatggcctgtttgagttctgtcagttgtctactggtggttctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcac
catgcaaagaagtccgaggcatctggcttctgttacgtcaatgatattgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccatggc
gacggtgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataag
tatggagagtacttcccaggaactggggacctacgggatatcggggctggcaaaggcaag
tattatgctgttaactacccgctccgagatgggattgatgacgaatcctatgaggccatt
ttcaagccggtcatgtccaaagtaatggagatgttccagcctagtgcggtggtcttacaa
tgtggctcagactccctatcgggggatcggttaggttgcttcaatctgaccatcaaaggg
catgccaagtgtgtggaatttgtcaagagctttaacctgcctatgctgatgctgggagga
ggtggttacaccattcgtaacgttgcccggtgctggacatacgagacagctgtggccctg
gatacggagatccctaatgagcttccatacaatgactacttcgaatactttggaccagat
ttcaagctccacatcagtccttccaatatgactaatcagaacacgaatgagtacctggag
aagatcaaacagcgactgtttgagaacctgaggatgctgccgcatgcacccggggtccaa
atgcaggcgattcctgaggacgccatccctgaggagagtggcgacgaggacgaagaagac
cctgacaagcgcatctcgatctgctcctctgacaaacgaattgcctgtgaagaagagttc
tcagactctgaagaggagggagaggggggccgcaagaactcttccaacttcaaaaaagcc
aagagagtcaaaacagaggatgaaaaagaaaaagagccagaggagaagaaagaagtcaca
gaagaggagaaaaccaaggaggagaagcccgaagccaaaggggtcaaggaggaggtcaag
ttggcctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101041477
Entry
101041477         CDS       T04350                                 

Gene name
HDAC2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04110  Cell cycle
sbq04213  Longevity regulating pathway - multiple species
sbq04330  Notch signaling pathway
sbq04613  Neutrophil extracellular trap formation
sbq04919  Thyroid hormone signaling pathway
sbq05016  Huntington disease
sbq05031  Amphetamine addiction
sbq05034  Alcoholism
sbq05165  Human papillomavirus infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05203  Viral carcinogenesis
sbq05206  MicroRNAs in cancer
sbq05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101041477 (HDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101041477 (HDAC2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101041477 (HDAC2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101041477 (HDAC2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    101041477 (HDAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101041477 (HDAC2)
   05202 Transcriptional misregulation in cancer
    101041477 (HDAC2)
   05206 MicroRNAs in cancer
    101041477 (HDAC2)
   05203 Viral carcinogenesis
    101041477 (HDAC2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101041477 (HDAC2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101041477 (HDAC2)
  09165 Substance dependence
   05031 Amphetamine addiction
    101041477 (HDAC2)
   05034 Alcoholism
    101041477 (HDAC2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101041477 (HDAC2)
   05165 Human papillomavirus infection
    101041477 (HDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sbq03036]
    101041477 (HDAC2)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101041477 (HDAC2)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     101041477 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     101041477 (HDAC2)
    BRAF-HDAC complex
     101041477 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101041477 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    101041477 (HDAC2)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 101041477
NCBI-ProteinID: XP_010347624
LinkDB
Position
Unknown
AA seq 279 aa
MKPHRIRMTHNLLLNYGLYKKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSK
QMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASG
FCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTG
DLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGD
RLGCFNLTVKDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
NT seq 840 nt   +upstreamnt  +downstreamnt
atgaaacctcatagaatccgcatgacccataacttgctgttaaattatggcttatacaaa
aaaatggaaatatataggccccataaagctactgccgaagaaatgacaaaatatcacagt
gatgagtatatcaaatttctacggtcaataagaccagataacatgtctgagtatagtaag
cagatgcaaagatttaatgttggagaagattgtccagtttttgatggactctttgagttt
tgtcagctctcaactggtggttcagttgctggggcggtgaagttaaaccgacagcagact
gatatggctgttaattgggctggaggattacatcatgctaagaaatcagaagcatcagga
ttctgttatgttaatgatattgtacttgccatccttgaattactaaagtatcatcagaga
gtcttatatattgatatagatattcatcatggtgatggtgttgaagaagctttttataca
acagatcgtgtaatgacagtatcattccataaatacggggaatactttcctggcacagga
gacttgagggatattggtgctggaaaaggcaaatactatgctgtcaattttccaatgaga
gatggtatagatgatgagtcatacgggcagatatttaagcctattatctcaaaggtgatg
gagatgtatcaacctagtgctgtggtattacagtgtggtgcagactcattatctggtgat
agactgggttgtttcaatctaacagtcaaagatgttaaagaagaagataaatccaaggac
aacagtggtgaaaaaacagataccaaaggaaccaaatcagaacagctcagcaacccctga

DBGET integrated database retrieval system