KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039983Help
Entry
101039983         CDS       T04350                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03030  DNA replication
sbq03410  Base excision repair
sbq03420  Nucleotide excision repair
sbq03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101039983 (LIG1)
   03410 Base excision repair
    101039983 (LIG1)
   03420 Nucleotide excision repair
    101039983 (LIG1)
   03430 Mismatch repair
    101039983 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sbq03032]
    101039983 (LIG1)
   03400 DNA repair and recombination proteins [BR:sbq03400]
    101039983 (LIG1)
Enzymes [BR:sbq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101039983 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     101039983 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     101039983 (LIG1)
DNA replication proteins [BR:sbq03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101039983 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101039983 (LIG1)
DNA repair and recombination proteins [BR:sbq03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101039983 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     101039983 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     101039983 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR Presenilin Asp-B-Hydro_N
Motif
Other DBs
NCBI-GeneID: 101039983
NCBI-ProteinID: XP_003940347
LinkDB All DBs
Position
Unknown
AA seq 918 aa AA seqDB search
MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKVALKEWNGVVSESDSPVKRPGRKA
ARVLGSEGEEEDADLSPAKGQKPAPNCPQVSPPRPATSPESNPSLSDTSPMDSSPSGIPK
RRTARKQLPKRTIEEVLEEESADKDREAKRKKEEEEAETPKENLTEAEVATEKEREDGDQ
PTTPPKPLKTSEAETPMESISEPEVATKQELQEEEQAKPARRAPKTLSSFFTPRKPAIKK
EMKEEELGAPGKEGAEGPLDPSGYNPAKNNYHPVEDACWKPGQKVPYLAVARTFEKIEEV
SARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNQLGPPQQGLELGVGDGVLLKAVAQAT
GRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFTKFRDIARLTGSASTAK
KIDIIKALFVACRHSEARYIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPPAVVD
AGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIVPVLLEHGLERLPEHCKLSPGIPLKP
MLAHPTRGINEVLKRFEEAAFTCEYKYDGQRAQIHALESGEVKIFSRNQEDNTGKYPDII
SRIPRIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDL
IYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDVEQIAEFLEQSVKDSCEGL
MLKTLDVDATYEIAKRSHNWLKMKKDYLSGVGDTLDLVVIGAYLGRGKRAGRYGGFLLAC
YEEDSEELQAICKLGTGFSDDELEAHHQSLQALVLPSPRPYVRTDDAVTPDHWLDPSAVW
EVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQSQ
IQNQQGEEDTGSDPEDTY
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatcatgtcatttttccaccccaagaaagagggtaaagcgaagaaacct
gagaaggaggcatccaacagcagcagagagacggagccccctccaaaggtggcactgaag
gagtggaatggagtggtgtccgagagtgactctccagtgaagaggccagggaggaaggcg
gcccgggtcctgggcagcgaaggggaagaggaggatgcagaccttagccctgccaaaggc
cagaagcctgccccgaactgcccacaggtctcccctccccgccctgccacatctcctgag
agcaacccttccctctccgacacctctcccatggacagctccccatcagggatcccgaag
cgtcgcacagctcggaagcagctcccaaaacggaccattgaggaagtcctggaagaggag
agtgcagacaaggacagagaagccaagaggaagaaggaggaagaagaagcagagaccccg
aaagaaaacctcacagaggctgaagtggcaacagagaaggaaagagaagacggggaccag
cccaccacacctccgaaacccctgaagacctctgaagcagagaccccgatggaaagcatt
tcagagcctgaggtggccacaaaacaggagctgcaggaggaggagcaggccaagcctgcc
cgcagagctcccaagacgctcagcagcttcttcaccccccggaagccagcaatcaaaaaa
gaaatgaaagaagaggagctaggggctccgggaaaggagggagctgagggacccctggac
ccatccggttacaatcctgccaagaacaactaccatcctgtggaagacgcctgctggaaa
ccgggccagaaggtcccttacctggcggtggcccggacgtttgagaagattgaggaggtt
tctgctcggctgcggatggtggagacgctgagcaacttgctgcgctccgtggtggctctg
tcgcccccagacctcctccctgtcctctacctcagcctcaaccagctggggccgccccag
cagggcctggagcttggcgtgggtgatggtgtccttctaaaggcagtggcacaggccaca
ggtcggcagctggagtctgtccgggctgaggcagccgagaagggtgacgtggggctggtg
gccgagaacagccgcagcacccagaggctcatgctgccacctcctccgctcactgcttcc
ggggtcttcaccaagttccgagacatcgccaggctcactggcagtgcttccacagccaag
aagatagacatcatcaaagccctctttgttgcctgccgccactcagaagcccggtacatc
gccaggtccctgagcggacggctgcgcctcgggctggcagagcagtcagtgctggctgcc
ctctcccaggctgtgagcctcacgcccccaggccaagaattcccaccggccgtggtggat
gctgggaagggcaagacagcagaggcccgaaagacatggctggaggagcaaggcatgatc
ctgaagcagacgttctgtgaggtgcctgacctggaccgaattgtccccgtgctgctggag
catggcctggaacgtctgccagagcactgcaagctgagcccaggaattcccctgaaacca
atgttggcccatcccactcggggcatcaatgaggttctgaaacgctttgaggaggcagct
ttcacctgcgaatacaaatatgacgggcagagggcacagatccacgctctggaaagcggg
gaggtgaagatcttcagcaggaaccaggaagacaacactgggaagtacccggacatcatc
agccgcatccccaggattaaactcccatcggtcacatccttcatcctggacaccgaagct
gtggcttgggaccgggaaaagaagcagatccagccattccaagtgctcaccacccgcaaa
cgcaaggaggtggatgcatctgagatccaggtgcaagtgtgtttgtacgccttcgacctc
atctacctcaatggagagtccctggtacgtgagcccctttcccgccgccggcagctgctc
agggagaacttcgtggagacagagggcgagttcgtctttgccacctccctggacaccaag
gacgtcgagcagatcgccgagttcctggagcagtcggtgaaagactcctgcgaggggcta
atgctgaagaccctggatgttgatgctacctatgagatcgccaagagatcacacaactgg
ctcaagatgaagaaggactacctcagtggcgtgggcgacactctggacctggtggtaatc
ggcgcctacctgggccgggggaagcgtgccggccgatacgggggcttcctgctggcctgc
tacgaggaggacagtgaggagctgcaggccatatgcaagcttggaactggcttcagcgat
gacgagctagaggcgcatcaccagagcctccaggccctggtgctgcccagcccacgcccc
tatgtgcggacggacgacgcggtgacccccgaccactggctggaccccagcgccgtgtgg
gaggtgaagtgcgctgacctctccctatctcccatctaccctgctgctcggggcctggtg
gatagtgacaagggcatctcccttcgcttccctcggttcattcgagtccgtgaagacaag
cagccggagcaggcgaccaccagtgcccaggtggcctgtttgtaccggaagcaaagtcag
attcagaaccagcaaggcgaggaggacacaggctctgaccctgaagatacctactaa

DBGET integrated database retrieval system