KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040048
Entry
101040048         CDS       T04350                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04020  Calcium signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04024  cAMP signaling pathway
sbq04260  Cardiac muscle contraction
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04270  Vascular smooth muscle contraction
sbq04713  Circadian entrainment
sbq04720  Long-term potentiation
sbq04723  Retrograde endocannabinoid signaling
sbq04724  Glutamatergic synapse
sbq04725  Cholinergic synapse
sbq04726  Serotonergic synapse
sbq04727  GABAergic synapse
sbq04728  Dopaminergic synapse
sbq04742  Taste transduction
sbq04911  Insulin secretion
sbq04912  GnRH signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04924  Renin secretion
sbq04925  Aldosterone synthesis and secretion
sbq04927  Cortisol synthesis and secretion
sbq04929  GnRH secretion
sbq04930  Type II diabetes mellitus
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq05010  Alzheimer disease
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05031  Amphetamine addiction
sbq05410  Hypertrophic cardiomyopathy
sbq05412  Arrhythmogenic right ventricular cardiomyopathy
sbq05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101040048 (CACNA1C)
   04020 Calcium signaling pathway
    101040048 (CACNA1C)
   04024 cAMP signaling pathway
    101040048 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    101040048 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101040048 (CACNA1C)
   04929 GnRH secretion
    101040048 (CACNA1C)
   04912 GnRH signaling pathway
    101040048 (CACNA1C)
   04921 Oxytocin signaling pathway
    101040048 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    101040048 (CACNA1C)
   04924 Renin secretion
    101040048 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    101040048 (CACNA1C)
   04927 Cortisol synthesis and secretion
    101040048 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101040048 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    101040048 (CACNA1C)
   04270 Vascular smooth muscle contraction
    101040048 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    101040048 (CACNA1C)
   04727 GABAergic synapse
    101040048 (CACNA1C)
   04725 Cholinergic synapse
    101040048 (CACNA1C)
   04728 Dopaminergic synapse
    101040048 (CACNA1C)
   04726 Serotonergic synapse
    101040048 (CACNA1C)
   04720 Long-term potentiation
    101040048 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    101040048 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    101040048 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101040048 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101040048 (CACNA1C)
   05020 Prion disease
    101040048 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    101040048 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    101040048 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101040048 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101040048 (CACNA1C)
   05414 Dilated cardiomyopathy
    101040048 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101040048 (CACNA1C)
   04934 Cushing syndrome
    101040048 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sbq04040]
    101040048 (CACNA1C)
Ion channels [BR:sbq04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101040048 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Etmic-2 DUF4834
Other DBs
NCBI-GeneID: 101040048
NCBI-ProteinID: XP_010343370
LinkDB
Position
Unknown
AA seq 2187 aa
MLRAFVQPGTPAYQPLPSHLSADTEVKFKGTLVHEAQLNCFYISPGGSNYGSPRPAHANM
NANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGT
VCRPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVI
FGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWN
RFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAE
MLLKMYSLGLQAYFVSLFNRFDCFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKI
TRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFD
NFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLA
IAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEVVEKPAAEESKEEKIELKSIT
ADGESPPTTKINMDDLQPNENEDKSPYPNPETTGEDDEEEPEMPVGPRPRPLSELHLKEK
AVPMPEASAFFIFSSNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRN
HILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSA
INVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQL
FKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFT
VSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQ
EQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLIL
LNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKHYFCDAWNTFDALI
VVGSIVDIAITEVNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLL
WTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLF
RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL
FVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGF
GKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEEGPSPSEAHPGAEDP
FRSAGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKF
KKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAAS
EDDIFRRAGGLFGNHVSYYQSDSRSAFPQTFTTQRPLHINKAGSSQGDTESPSHEKLVDS
TFTPSSYSSTGSNANINNANNTALGRLPRPAGHPSTVSTVEGHGPPLSPAIRVQEVAWKL
SSQRCHSRESQTATVGQEETSQDETYEVKMNDDMEACSEPTLLSTEMLSYQDDENRQLTI
PEEDKRDIRQSPKRGFLRTASLGRRASFHLECLKRQKDRGGDISQKTVLPLHLVHHQALA
VAGLSPLLQRSHSPASFPRPFATPPATPGSRGWPPQPIPTLRLEGAESSEKLNSSFPSIH
CGSWAETTPCGGGSSTARRARPVSLMVPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQ
DPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAGQDLAGGE
EDAGCVRARARLSEEELQDSRVYVSSL
NT seq 6564 nt   +upstreamnt  +downstreamnt
atgcttcgagcatttgttcagcctggtacacctgcataccagccgcttcccagccacctg
tctgctgatacggaggtcaaatttaagggtactttggtgcatgaagctcaactcaactgt
ttctacatctctcctggaggttccaactatgggagcccacgccccgcccatgccaacatg
aatgccaacgcggcggcggggctggcccctgagcacatccccaccccgggggctgccctg
tcctggcaggcagccatcgacgcagcccggcaggctaagctgatgggcagcgctggcaac
gcgaccatctccacggtcagctccacgcagcggaagcggcagcaatatgggaaacccaag
aagcagggcagcaccacggccacacgcccgccccgagccctgctctgcctgaccctgaag
aaccccatccgaagggcctgcatcagcattgtcgaatggaaaccatttgaaataattatt
ttactgactatttttgccaattgtgtggccttagcgatctatattccctttccagaagat
gattccaacgccaccaattccaacctggaacgagtggaatatctctttctcataattttt
acggtggaagcatttttaaaagtaatcgcctatggactcctctttcaccccaatgcctac
ctccgcaacggctggaatctcctagattttataattgtggttgtggggctttttagtgca
attttagaacaagccaccaaagcagatggggcaaacgctcttggagggaaaggggccgga
tttgatgtgaaggcgctgagggccttccgcgtgctgcgtcccctgcggctggtgtctgga
gtcccaagtctccaggtggttctgaattctatcatcaaggccatggtccccctgctgcac
atcgccctgcttgtgctgtttgtcatcatcatctacgccatcatcggcctggagctcttc
atggggaagatgcacaagacctgctataaccaggagggcatagcagatgttccagcagaa
gatgacccttccccttgtgcgctggaaacaggacatgggcggcagtgccagaatggcaca
gtatgcaggcccggctgggatgggcccaagcacggcatcaccaactttgacaactttgcc
ttcgccatgctcacagtgttccagtgcatcaccatggagggctggacggacgtgctgtac
tggatgcaggacgctatgggctatgagttaccctgggtgtattttgtcagtctggtcatc
tttggatcctttttcgttctaaatctggttctcggtgtgttgagcggagagttttccaaa
gagagggagaaggccaaggcccggggagatttccagaagctgcgggagaagcaacagctg
gaagaggatctcaaaggctacctggactggatcactcaggccgaagacattgacccggag
aacgaggacgaaggcatggatgaggagaagccccgaaacatgagcatgcccaccagtgag
accgagtctgtcaacaccgaaaacgtggctggaggtgacatcgagggagaaaactgcggg
gccaggctggcccaccggatctccaagtcaaagttcagccgctactggcgccgatggaat
cggttctgcagaagaaagtgccgtgctgcagtcaagtctaatgtcttctactggctggtg
atattcctggtgttcctcaacacgctcaccattgcctctgagcactacaaccagccccac
tggctcacagaagtccaagacacggccaacaaggccctgctggccctgttcacggcagag
atgctcctgaagatgtacagcctgggcctgcaagcctacttcgtgtccctcttcaaccgc
tttgactgcttcgttgtgtgcggcggcatcctggagaccatcctggtggagaccaagatc
atgtccccactgggcatctctgtgctcagatgcgtccggctgctgaggatattcaagatc
acaaggtactggaactccttgagcaacctggtggcgtccttgctgaactctgtgcgctcc
atcgcctccctgctccttctcctcttcctcttcatcatcatcttctccctcctggggatg
cagctctttggaggaaagttcaactttgatgagatgcagacccggaggagcacatttgat
aacttcccccagtccctcctcactgtgtttcagatcctgaccggggaggactggaattcg
gtgatgtatgatgggatcatggcttatggcggcccctcttttccagggatgttagtctgt
atttacttcatcatcctcttcatctgtggaaactatatcctactgaatgtgttcttggcc
attgctgtggacaacctggctgatgctgagagcctcacatctgcccaaaaggaggaggaa
gaggagaaggagagaaagaagctggccaggactgccagcccagagaagaaacaagaggtg
gtggagaagccagcagcggaggaatccaaggaggagaagattgagctgaaatccatcaca
gctgacggggagtctccacccaccaccaagatcaacatggatgacctccagcccaatgaa
aatgaggataagagcccctaccccaacccagaaactacaggagaagatgatgaggaagag
ccagagatgcctgtcggccctcgcccacgaccactctctgagcttcaccttaaggaaaag
gcagtgcccatgccagaagccagcgcatttttcatcttcagctctaacaacaggtttcgc
ctccagtgccaccgcattgtcaatgacacgatcttcaccaacctgatcctcttcttcatt
ctgctcagcagcatttccctggctgctgaggacccggtccagcacacctccttcaggaac
catattctgttttattttgatattgtttttaccaccattttcaccattgaaattgctctg
aagatgactgcttacggagctttcctgcacaagggctctttctgccggaactacttcaac
atcctagacctgctggtggtcagcgtgtccctcatctcctttggcatccagtccagtgca
atcaatgttgtgaagatcttgcgagtcctgcgagtactccggcccctgagggccatcaac
agggccaaggggctaaagcatgtggttcagtgcgtgtttgtcgccatccggaccatcgga
aacatcgtcattgtcaccaccctgctgcagttcatgttcgcctgcatcggagtccagctc
ttcaagggaaagctgtacacctgttcagacagttccaagcagacagaggcagaatgcaag
ggcaactacatcacgtacaaagacggggaggttgaccaccccatcatccagccccgcagc
tgggagaacagcaagtttgactttgacaacgttctggcagccatgatggccctcttcaca
gtctccacctttgaagggtggccagagctgctgtaccgctccatcgactcccacacggaa
gacaagggccccatctacaactaccgcgtggagatctccatcttcttcatcatctacatc
atcatcatcgccttcttcatgatgaacatcttcgtgggtttcgtcatcgtcaccttccag
gagcagggggagcaggagtacaagaactgtgaactggacaagaaccagcggcagtgtgtg
gaatatgccctcaaggcccggcccctacggaggtacatccccaagaaccagcaccagtac
aaagtctggtacgtggtcaactccacctacttcgagtacctgatgttcgtcctcatcctg
ctcaataccatctgcctggccatgcagcactacggccagagctgcctgttcaaaatcgcc
atgaacatcctcaacatgctcttcactggcctcttcactgtggagatgatcctgaagctc
attgccttcaaacccaagcactatttctgtgatgcatggaatacatttgacgccttgatt
gttgtgggtagcattgttgatatagcaatcaccgaggtaaacccagctgaacatacccaa
tgctctccctctatgaacgcagaggagaactcccgcatctccatcaccttcttccgcctg
ttccgggtcatgcgcctggtgaagctgctgagccgcggggagggcatcaggacgctgctg
tggaccttcatcaagtccttccaggccctgccctatgtggccctcctgatcgtgatgctg
ttcttcatctacgcggtgatcgggatgcaggtgtttgggaaaattgccctgaatgatacc
acagagatcaaccggaacaacaactttcagaccttcccccaagctgtgctgctcctcttc
aggtgtgccactggggaggcctggcaggacatcatgctggcctgcatgccaggcaagaag
tgtgccccagagtctgagcccagcaacagcacagagggtgaaacgccctgtggcagcagc
tttgccgtcttctacttcatcagcttctacatgctctgtgccttcctgatcatcaacctc
tttgtagctgtcatcatggacaacttcgactacctgacaagggactggtccatccttggt
ccccaccatctggatgagtttaaaagaatctgggcagagtatgaccctgaagccaagggt
cgtatcaaacacctggatgtggtgactcttctccggcggattcagcccccactgggtttt
gggaagctgtgccctcaccgtgtggcttgcaaacgcctggtctccatgaacatgcctctg
aacagcgacgggacagtcatgttcaatgccaccctgtttgccctggtcaggacagccctg
aggatcaaaacagaagagggacccagcccatcagaggcccacccaggggctgaggatcct
ttccgctctgcagggaacctagaacaagccaacgaggagctacgggccatcatcaagaag
atctggaagcggaccagcatgaagctgctggaccaggtggtgccccctgcaggtgatgat
gaggtcaccgttggcaagttctacgccacgttcctgatccaggagtacttccggaagttc
aagaagcgtaaagagcagggccttgtgggcaagccctcccagaggaacgcgctgtctctg
caggctggcttgcgcacgctgcatgacatcgggcctgagatccgacgggccatctctgga
gatctcactgctgaggaggagctggacaaggccatgaaggaggctgtgtccgctgcctct
gaagatgacatcttcaggagggccggtggcctgttcggcaaccacgtcagctactaccaa
agtgacagccggagcgccttcccccagaccttcaccactcagcgcccgcttcacatcaac
aaggcaggcagcagccagggcgacacagagtcgccttcccacgagaagctggtggactcc
accttcacccccagcagctactcgtccaccggttccaacgccaacatcaacaatgccaac
aacaccgccctgggccgcctcccccgccccgccggccaccccagcacggtcagcactgtg
gagggccatgggccccccttgtcccctgccatccgggtgcaggaggtggcgtggaagctc
agctcccagaggtgccactcccgggagagccagacagccacggtgggtcaggaggagaca
tctcaggatgagacctatgaagtgaagatgaacgatgacatggaggcctgcagtgagccc
accctgctctccacagagatgctctcctaccaggatgacgaaaatcggcaactgaccatc
ccagaggaggacaagagagacatccggcaatccccaaagaggggtttcctccgcaccgcc
tcactaggtcgaagggcctccttccacctggaatgtctgaagcgacagaaggaccgaggg
ggagacatctctcagaagacagtcctgcccttgcatctggttcatcatcaggcactggca
gtggcaggcctgagccccctcctccagagaagccattcccccgcctcattccccaggcct
tttgccacccccccggccacacctggcagccgaggctggcccccacagcccatccccacc
ctgcggctagaaggggccgagtccagcgagaaactcaacagcagcttcccgtccatccac
tgcggctcctgggctgagaccaccccctgtggcgggggcagcagcaccgcccggagagcc
cggcccgtctccctcatggtgcccagccaggctggggccccagggaggcagttccacggc
agtgccagcagcctggtggaagcggtcttgatttcagaaggactggggcagtttgctcaa
gatcccaagttcatcgaggtcaccacccaggagctggccgacgcctgcgacatgaccata
gaggagatggagagcgcggccgacaacatcctcagcgggggcgccccacagagccccaat
ggcgccctcttaccctttgtgaactgcagggacgcggggcaggacctagccgggggcgaa
gaggacgcgggctgtgtgcgcgctcgggcgcgactgagtgaggaggagctccaggacagc
agggtctacgtcagcagcctgtag

DBGET integrated database retrieval system