KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040060
Entry
101040060         CDS       T04350                                 

Gene name
NFATC3
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3 isoform X1
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04218  Cellular senescence
sbq04310  Wnt signaling pathway
sbq04360  Axon guidance
sbq04625  C-type lectin receptor signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04921  Oxytocin signaling pathway
sbq05135  Yersinia infection
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101040060 (NFATC3)
   04310 Wnt signaling pathway
    101040060 (NFATC3)
   04022 cGMP-PKG signaling pathway
    101040060 (NFATC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101040060 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101040060 (NFATC3)
   04660 T cell receptor signaling pathway
    101040060 (NFATC3)
   04658 Th1 and Th2 cell differentiation
    101040060 (NFATC3)
   04659 Th17 cell differentiation
    101040060 (NFATC3)
   04662 B cell receptor signaling pathway
    101040060 (NFATC3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101040060 (NFATC3)
  09158 Development and regeneration
   04360 Axon guidance
    101040060 (NFATC3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101040060 (NFATC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101040060 (NFATC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101040060 (NFATC3)
   05170 Human immunodeficiency virus 1 infection
    101040060 (NFATC3)
   05161 Hepatitis B
    101040060 (NFATC3)
   05163 Human cytomegalovirus infection
    101040060 (NFATC3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101040060 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101040060 (NFATC3)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    101040060 (NFATC3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 101040060
NCBI-ProteinID: XP_010345129
UniProt: A0A2K6TT95
LinkDB
Position
Unknown
AA seq 1075 aa
MTTANCGAHDELDFKLVFGEDGASAPPPPGSRPADLEPDDCASIYIFNVDPPPSALNTPL
CLPHHGLPSHSSVLSPSFQLQSHKNYEGTCEIPESKYIPLSGPKPFECPSIQITSISPNC
HQEIDAHEDDLQINDPEREFLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDAS
SCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEETWHQQYGLGHSLSPRQS
PCHSPRSSITDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYGGSLSPHHSPIPSPGHS
PRGSVTEDTWLNASVHGGSGLGPAVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSD
DQGSLSPSRETSVDDGLGSQYPLKKDSSGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPL
DWPLPAHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYNEKPINLQM
FIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGI
LKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGKVLSLQIASIPVECSQRSAQELP
HIEKYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIREKCQGAHI
VLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHREEIDLSSVPSLPV
PHPAQTQRPSSDSERPHDSVLSTQRTLVCSIPQTYASMVTSSHLPQLQCRDESASKEQHM
IPSPVVHQPFQVTPTPPVGSSYQPMQTNIVYNGPTCLPLNAASSQEFDSVLFQQDAALPS
LVNLGCQPLSSLPFHSSNSGSTGHLLAHTPHSVHTLPHLQSVGYHCSNTGQRSLSSPVAD
QITGQPSSQLQPVTYGPSHSGSTATASPAASHPLASSPLSGPPSPQLQPMSYQSPSSGTA
SSPSPATRMHSGQHSTQAQNTGQGGLSAPSSLICHSLCDPASFPPDGATVSIKPEPEDQE
PNFATIGLQDITLDDVNEIIGRDMSQISVSQGAGVSRQAPLPSPESLDLGRSDGL
NT seq 3228 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgtggcgcccacgacgagctcgacttcaaactcgtctttggcgag
gacggggcgtcggcgccgccgcccccgggctcgcggcctgcagatcttgagccagatgat
tgtgcatccatttacatctttaatgtagatccacctccatctgctctaaacacaccactt
tgcttaccacatcatggattaccatctcactcttctgttttgtcaccatcgtttcagctc
caaagtcacaaaaactatgaaggaacttgtgagattcctgaatctaaatatatcccatta
agtggccccaaaccctttgagtgcccaagtattcaaattacatctatctcccctaactgt
catcaagaaatagatgcgcatgaagatgacctacagataaatgacccagaaagggaattt
ttagaaagaccttctagagatcatctctatcttcctcttgagccatcctaccgggagtct
tctcttagtcctagtcctgccagcagcatctcttctaggagctggttctcggatgcatct
tcttgtgaatcactttcacatatttatgatgatgttgactcagagttgaatgaagctgca
gcccggtttacccttggatctcctctgacttctcctggtggctctccagggggctgccct
ggagaagaaacttggcatcaacagtatggacttggacactcattatcacctaggcaatct
ccttgccactctcctagatccagtatcactgatgagaattggctgagccccaggccagct
tcaggaccctcatcgaggcccacttccccctgtgggaaacggaggcactccagtgctgaa
gtttgttatggtgggtccctttcaccccatcactcacctattccttctcctggtcactcc
cccaggggaagtgtgacagaagatacctggctcaatgcttctgtccatggtgggtcaggc
cttggccctgcagtttttccatttcagtactgtgtagagactgacatccctctgaaaaca
aggaagacttctgaagatcaagctgccatactaccaggaaaattagagctctgttcagat
gaccaagggagtttatcaccatcccgggagacttcagtagatgatggccttggatctcag
tatcctttaaagaaagattcatctggtgatcagtttctttcagttccttcaccctttacc
tggagcaaaccaaagcctggccacacccctatatttcgcacatcttcattacctccacta
gactggcctttaccagctcattttggacaatgtgaactgaaaatagaagtacagcctaaa
actcatcatcgagcccattatgaaacagaaggtagtcgaggggcagtaaaagcatctact
gggggacatcctgtcgtgaagctcctgggctataacgaaaagccgataaatctacaaatg
tttattgggacagcagatgatcgatatttacgacctcatgcattttaccaggtgcatcga
atcactgggaagacagttgctactgcaagccaagagataataattgccagtacaaaagtt
ctggaaattccacttcttcctgaaaataatatgtcagccagtattgactgtgcaggtatt
ttgaaacttcgcaattcagatatagaacttcgaaaaggagaaactgatattggcagaaag
aatactagagtacgacttgtgtttcgtgtacacatcccacagcccaatggaaaagttctt
tctctgcagatagcttctatacctgttgagtgctcccagcgatctgctcaagaacttcct
catattgagaagtacagtatcaacagttgttctgtaaatggaggtcatgaaatgattgtg
actggatctaattttcttccagaatccaaaatcatttttctggaaaaaggacaagatgga
cgacctcagtgggaggtagaagggaaaataatcagggaaaaatgtcaaggggctcacatt
gtccttgaagttcctccatatcataacccagcagttacagctgcagtgcaggtgcacttt
tatctttgcaatggcaagaggaaaaaaagccagtctcaacgttttacttacacaccagtt
ttgatgaagcaagagcacagagaagagattgatttgtcttcagttccatctttgcctgtg
cctcatcctgctcagacccagaggccttcttctgattcagagcgcccacacgacagtgta
ctgtcaacacagagaactttggtttgttccatcccacaaacatatgcatccatggtgacc
tcatcccatctgccacagttgcagtgtagagatgagagtgcaagtaaagaacagcatatg
attccttctccagttgtacaccagccttttcaagtcacaccaacacctcctgtgggatct
tcctatcagcctatgcaaactaacattgtgtacaatggaccaacttgtcttcctcttaat
gctgcctctagtcaagaatttgattcagttttgtttcagcaggatgcagctcttcctagt
ttagtgaatcttggctgtcaaccactatcatccctaccatttcattcttcaaattcaggc
tcaacaggacatctcttagcacatacacctcattctgtgcataccctgcctcatctgcaa
tcagtgggatatcactgttcaaatacaggacaaagatctctttcttctccagtggctgac
cagatcacaggtcagccttcttctcagttgcaacctgttacatatggtccttcacattca
gggtctactgcaacagcttccccagcagcttctcatcccttggctagttcaccactttct
gggccaccatctcctcagcttcagcccatgtcttaccagtctcctagctcaggaactgcc
tcatcaccgtctccagccaccagaatgcattctggacagcactcaactcaagcacaaaat
acaggccaagggggtctttctgcaccttcatctttaatatgtcacagtctgtgtgatcca
gcttcatttccacctgacggggcaactgtgagcattaaacctgaaccagaagatcaggag
cctaactttgcaaccattggtctgcaggacatcactttagatgatgtgaacgagataatt
gggagagatatgtcccagatttctgtttcccaaggagcaggagtgagcaggcaggctccc
ctcccgagtcctgagtccctggatttaggaagatccgacgggctctaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043069
Entry
101043069         CDS       T04350                                 

Gene name
NFATC4
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 4 isoform X1
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04022  cGMP-PKG signaling pathway
sbq04218  Cellular senescence
sbq04310  Wnt signaling pathway
sbq04360  Axon guidance
sbq04625  C-type lectin receptor signaling pathway
sbq04921  Oxytocin signaling pathway
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101043069 (NFATC4)
   04022 cGMP-PKG signaling pathway
    101043069 (NFATC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101043069 (NFATC4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101043069 (NFATC4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101043069 (NFATC4)
  09158 Development and regeneration
   04360 Axon guidance
    101043069 (NFATC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101043069 (NFATC4)
   05170 Human immunodeficiency virus 1 infection
    101043069 (NFATC4)
   05161 Hepatitis B
    101043069 (NFATC4)
   05163 Human cytomegalovirus infection
    101043069 (NFATC4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101043069 (NFATC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101043069 (NFATC4)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    101043069 (NFATC4)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 101043069
NCBI-ProteinID: XP_010333289
LinkDB
Position
Unknown
AA seq 995 aa
MGRHWGYSPEPQGFRDWRRCGLLESFEAVWEEMITTPQSLLPSSLASISHRVANLPSNSL
SHNPGLSKPDFPENSCPGLSSSSNPGRDLGAPAGSMGAASCEDEELEFKLVFGEEKEAPP
LGAGGLGEELDSEDAPPCCRLALGEPPPYGAAPIGIPRSPPPRPGMHSPPPRPAPSPGTW
ESQPARSVRLGGPGGGTGGAGGGRVLECPSIRITSISPTPEPPAALEDNPDAWGDGSPRD
YPSPEGFGGYREAGGQGGGAFFSPSPGSSSLSSWSFFSDASDEAALYAACDEVESELNEA
ASRFGLGSPLPSPRASPRPWTPEDPWSLYGPSPGGRGPEDSWLLLSAPGPTPASPRPASP
CGKRRYSSSGTPSSASPALSRRGSLGEEGSEPPPPPPLPLAHDPGSPGPFDYVGAPPAES
IPQKTRRTSSEQTVALPRSEEPAPCNGKLPLGAEESVALPGGPRKEVAGMDYLAVPSPLA
WSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELRIEVQPRAHHRAHYETEGSRGAVKAA
PGGHPIVKLLGYSEKPLTLQMFIGTADERNLRPHAFYQVHRITGKMVATASYEAVVSGTK
VLEMTLLPENNMAANIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQGGGKV
ISVQAASVPIECSQRSAQELPQVEAYSPSACSVRGGEELVLTGSNFLPDSKVVFIERGPD
GKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSRPVQVYFYVSNGRRKRSPTQSFKFLP
VICKEEPLPDSSLRGFPPASAPPFGTDMDFSPPRPPYPSYPHEDPAYETPYLSEGFSYGT
PPLYPQTGPPPSYRPGLRMFPETRGTTGCAHPPPVSFLPRPFPSDPYGGRGSSFPLGLPF
SPPAPFRPPLPASPPLEGPFPSQGDVHPLPAEGYNKVGPGYGPGEGAPEQEKSRGGYGSG
FRDSVPIQGITLEEGGCGTGGCECECVQEIALHVC
NT seq 2988 nt   +upstreamnt  +downstreamnt
atggggcggcattgggggtacagccctgaaccccagggatttagagattggagacgctgc
ggcctcttagagagctttgaagctgtgtgggaggaaatgataaccaccccccaatctctc
ctaccctccagccttgccagtatctcccaccgagtcgcgaatctcccctctaattccctc
tcacacaacccaggcctctccaagcctgattttcccgaaaactcctgtccgggtctttct
tcctcctccaacccaggccgggacctgggggctcctgccggatccatgggggcggccagc
tgcgaggatgaggagctggaatttaagctggtgttcggggaggaaaaggaggcccccccg
ctgggcgcgggggggttgggggaagaactggactcagaggatgccccgccatgctgccgt
ctggccttgggagagccccctccctatggcgctgcgccaatcggtattccccgttctcca
ccccctcggcctggcatgcattcgccaccgccgcgcccagccccctcacctggcacctgg
gagagccagcccgcccgctcggtgaggctgggaggaccaggagggggtactgggggtgct
gggggtggccgtgttctcgagtgtcccagcatccgcatcacctccatctctcccacgccc
gagccgccggcagcgctggaggacaaccctgatgcctggggggacggctctcctagagat
tacccctcaccagaaggctttgggggctaccgagaggcagggggccagggtgggggggcc
ttcttcagcccgagccctggcagcagcagcctgtcctcctggagcttcttctccgatgcc
tctgatgaggccgccctgtacgcagcctgtgacgaagtggagtctgagctaaatgaggcg
gcctcccgctttggcttgggctccccactgccctcgccccgggcctcccctcggccatgg
acccctgaagatccctggagtctgtatggtccaagccccggaggccgagggccagaggat
agctggctactcctcagtgctcctgggcccaccccagcctctcctcggcctgcttctcca
tgtggcaagcggcgctattccagttcgggaaccccatcttcggcctccccagctctgtcc
cgccgtggcagcctgggagaagagggatctgagccacctccaccacccccattgcctctg
gcccatgaccctggctcccctggtccctttgactatgtgggggccccaccagctgagagc
atccctcagaagacacggcgaacttccagtgagcagacggtggctctgcctcggtctgag
gagcctgctccatgcaatgggaagctgcccttgggagcagaggagtctgtggctcttccc
ggaggtccccggaaggaggtggctggcatggactacctggcagtgccctccccactcgcg
tggtccaaggctcggattgggggacacagccctatcttcaggacctctgccctaccaccc
ctggactggcctctgcccagccaatatgagcagctggagctgaggattgaggtgcagcct
agagcccaccaccgggcccactatgagacagaaggcagccgtggagctgtcaaagctgcc
cctggcggtcaccccatagtcaagctcctaggctacagtgagaagccactgaccctacag
atgttcatcggcactgcagatgaaaggaacctgcggcctcatgccttctatcaggtgcac
cgtatcacgggcaagatggtggccacggccagctatgaagccgtagtcagtggcaccaag
gtgctggagatgactttgctgcctgagaacaacatggcggccaacattgactgtgcggga
atcctgaagcttcggaattcagacattgagcttcggaagggtgagacggacatcgggcgc
aaaaatacacgtgtgcggctggtgttccgggtacatgtgccccagggcggcgggaaggtc
atctcagtacaggcagcatcggtgcccatcgagtgctcccagcgctcagctcaggagctg
ccccaggtggaggcctacagccccagtgcctgctctgtgagaggaggcgaggaactagta
ctgactggctccaacttcctgccagactccaaggtggtgttcattgagaggggtcctgat
gggaagctgcaatgggaggaggaggccacggtgaacagactgcagagcaatgaggtgacg
ctgaccctgactgtccccgagtacagcaacaaaagggtgtcccggccagtccaggtctac
ttttatgtctccaatgggcggaggaaacgcagtcctacccagagtttcaagtttttgcct
gtgatctgcaaggaggagcccctaccggactcatctctgcggggcttccctccagcatcg
gcacccccctttggcactgacatggacttctcaccacccaggcccccctacccctcctat
ccccatgaagaccctgcttatgaaactccttacctatcagaaggcttcagctatggcaca
ccccctctgtacccccagacggggcccccaccatcctacagaccgggcctgcggatgttc
cctgagactaggggtaccacaggttgtgcccacccaccaccagtctccttccttccccgc
cccttccctagtgacccgtatggtgggcggggctcctcttttcccctggggctgccattc
tctcctccagccccctttcggcctcctctccctgcatccccaccgcttgaaggccccttc
ccttcccagggtgatgtgcatcccctacctgctgagggatacaataaggtagggccaggc
tatggccctggggagggggctccggagcaggagaaatccaggggtggctacggcagcggc
ttcagagacagtgtccctatccagggtatcacgctggaggaaggtgggtgtgggactggg
ggctgtgagtgtgagtgtgtgcaagagattgctctgcatgtttgctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101049490
Entry
101049490         CDS       T04350                                 

Gene name
NFATC2
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2 isoform X1
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04022  cGMP-PKG signaling pathway
sbq04218  Cellular senescence
sbq04310  Wnt signaling pathway
sbq04360  Axon guidance
sbq04370  VEGF signaling pathway
sbq04380  Osteoclast differentiation
sbq04625  C-type lectin receptor signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04921  Oxytocin signaling pathway
sbq05135  Yersinia infection
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101049490 (NFATC2)
   04370 VEGF signaling pathway
    101049490 (NFATC2)
   04022 cGMP-PKG signaling pathway
    101049490 (NFATC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101049490 (NFATC2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101049490 (NFATC2)
   04650 Natural killer cell mediated cytotoxicity
    101049490 (NFATC2)
   04660 T cell receptor signaling pathway
    101049490 (NFATC2)
   04658 Th1 and Th2 cell differentiation
    101049490 (NFATC2)
   04659 Th17 cell differentiation
    101049490 (NFATC2)
   04662 B cell receptor signaling pathway
    101049490 (NFATC2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101049490 (NFATC2)
  09158 Development and regeneration
   04360 Axon guidance
    101049490 (NFATC2)
   04380 Osteoclast differentiation
    101049490 (NFATC2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101049490 (NFATC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101049490 (NFATC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101049490 (NFATC2)
   05170 Human immunodeficiency virus 1 infection
    101049490 (NFATC2)
   05161 Hepatitis B
    101049490 (NFATC2)
   05163 Human cytomegalovirus infection
    101049490 (NFATC2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101049490 (NFATC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101049490 (NFATC2)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    101049490 (NFATC2)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 101049490
NCBI-ProteinID: XP_003932628
UniProt: A0A2K6T1B6
LinkDB
Position
Unknown
AA seq 923 aa
MNAPGQQLEPDGGDAPGHEPGGSPQDELDFSILFDYEYMNPNEEEPNAHKVASPPSGPAY
PDDVLDYGLKPYSPFTSLPGEPPGRFAEPDRVGPQNFLGPAKPAGASGLSPRIEITPSHE
LIQAGGPLRMRDAGVEQVPPAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDT
FSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPA
SRSSSPGAKRRHSCAEALVAPLPGASPQRSRSPSPQPSSHVAPQDHGAPAGYPPVAGSAV
IMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHLYPAVEFLGPCEQEERRN
SAPESILLVPPTWPKQLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHHRA
HYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGK
TVTTTSYEKIVGNTKVLEIPLEPKNNMKATIDCAGILKLRNADIELRKGETDIGRKNTRV
RLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQN
FTAESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVIN
GKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTHGGLGSQPYYPQHPMVAESPSCLV
ATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPGLLSYQQPALMAAPLSLADAHR
SVLVHAGSQGQSSALLHPSPTNQQSSPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTA
RPGPPPVSQGQRLSPSSYPTVIQQQNATSQRATKNGPPVSDQKEVLPAGVTVKQEQNLDQ
TYLDDVNEIIRKEFSGPPARNQT
NT seq 2772 nt   +upstreamnt  +downstreamnt
atgaacgcccccgggcagcagctcgaacccgacggtggggacgccccaggccatgagccc
gggggcagcccccaagacgagcttgacttctccatcctcttcgactatgagtatatgaat
ccgaacgaagaagagccgaatgcacataaggtcgccagcccaccctccggacccgcatac
cccgatgatgtcctggactatggcctcaagccatacagcccctttaccagtctcccgggc
gagccccccggccgattcgcagagcccgatagggtagggccgcagaactttctgggcccg
gccaagccagcgggggcctcgggcctgagccctcggatcgagatcactccgtcccacgaa
ctgatccaggcaggggggcccctccgcatgagagacgcgggcgtggagcaggtgcccccg
gccggggtggccgccagcccgcggttcacgctgcccgtgcccggcttcgagggctaccgc
gagccgctttgcttgagcccggctagcagcggctcctctgccagcttcatttctgacacc
ttctccccctacacctcgccctgcgtctcgcccaataacggcgggcccgacgacctgtgt
ccgcagtttcaaaacatccctgctcattattcccccagaacctcgccaataatgtcacct
cgaaccagcctcgccgaggacagctgcctgggccgccattcgcccgtgccccgtccggcc
tcccgctcctcgtcgcctggtgccaagcggaggcattcgtgcgccgaggccttggttgcc
ccgctgcccggagcctcaccccagcgctcccggagcccctcgccgcagccctcatctcac
gtggcaccccaggaccacggcgccccggctgggtacccccctgtggctggctctgccgtg
atcatggatgccctgaacagcctcgccacggactcgccttgtgggatcccccccaagatg
tggaagaccagccctgacccctcgcccgtgtccgccgccccgtccaaggccggcctgccc
cgccacctctacccggccgtggagttcctggggccctgcgagcaggaggagaggagaaac
tcagcgcccgaatccatcctgctggtcccgcccacgtggccgaagcagctggtgcctgcc
attcccatctgcagcatcccagtgactgcatccctccctccgcttgagtggccactctcc
agtcagtcaggctcttatgagctgcggatcgaggtgcagcccaagccacatcaccgggcc
cactatgagacagaaggcagccgaggggctgtcaaagctccaacggggggccaccctgtg
gttcagctccatggctacatggaaaacaagcctctgggacttcagatcttcattgggaca
gctgatgagcggatccttaagccacacgccttctaccaggtgcaccgaatcacggggaaa
actgtcaccaccaccagttacgagaagattgtgggcaacaccaaagtcctggagatcccc
ctggagccaaaaaacaacatgaaggcaaccatcgactgtgcggggatcttgaagcttaga
aacgccgacattgagctgcggaaaggtgagacggacattggaagaaagaacacgagggtg
aggctggttttccgagttcacattccagagtccagtggcaggattgtgtctttgcagact
gcatctaaccccatcgagtgctcccagcgatctgcccatgagctgcccatggttgaaaga
caagacacggacagctgcctggtctatggaggccagcaaatgatcctcacggggcagaac
tttacggccgagtccaaagtcgtgtttactgagaagaccacagatgggcagcaaatttgg
gagatggaagccacggtggataaggacaagagccagcccaacatgctttttgttgagatt
cccgagtatcggaacaagcacatccgcacacctgtaaaagtgaacttctacgtcatcaat
ggaaaaagaaaacgaagtcagcctcagcactttacctaccacccagtcccagccatcaag
acggagcccacggatgagtatgaccccactctgatctgcagccccacccatggaggcctg
gggagccagccttactacccccagcacccgatggtggccgagtccccctcctgcctcgtg
gccaccatggctccctgccagcagttccgcacggggctctcatcccctgacgctcgctac
cagcaacagaacccagcagccgtgctctaccagcggagcaagagcctgagccccggcctg
ctgagctaccagcagccggccctcatggccgccccgctgtccctggcggacgctcaccgc
tctgtgctggtgcacgcgggctcccagggccagagctcagccctgctccacccttctccg
accaaccagcagtcctcgccggtgatccattactcacccaccaaccagcagctgcgctgc
ggaagtcaccaggagttccagcacatcatgtactgcgagaatttcgcaccaggcaccgcc
aggcctggcccgcctcccgtcagtcaaggtcagaggctgagcccgagttcctaccccacc
gtcattcagcaacagaatgccacaagccaaagagccaccaaaaacggacccccagtcagt
gaccaaaaggaagttttacctgcaggagtgaccgtcaagcaggagcagaacctggaccag
acctacttggatgacgttaatgaaattatcaggaaggagttttcaggacctcccgccaga
aatcagacgtaa

DBGET integrated database retrieval system