KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040138
Entry
101040138         CDS       T04350                                 

Gene name
PTGDR
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101040138 (PTGDR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sbq04030]
    101040138 (PTGDR)
G protein-coupled receptors [BR:sbq04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    101040138 (PTGDR)
SSDB
Motif
Pfam: 7tm_1 PhoR ResB
Other DBs
NCBI-GeneID: 101040138
NCBI-ProteinID: XP_003930573
UniProt: A0A2K6UBR9
LinkDB
Position
Unknown
AA seq 359 aa
MRLPFYRCQNTTSVEKGNSATMSGVLFSTGLLGNLLALGLLARSGLGWCPPRPPRPPPSV
FYVLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLEPALDNSLCQGFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRQHITLRRGALVAPVVSAFCLAFCALPFVGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYEMHRRLQRHPRSCT
RDRTKPHANEREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLQALRFLSVISIVDPWIFIIFRAPVFRMFFHKIFIRPLKYRNWCSNSTNMESSL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgaggttgcccttctaccgctgccagaacaccacctcggtggaaaagggcaactcggcg
accatgagtggggtgctcttcagcaccggcctcttgggcaacctgctggccctggggctg
ctggcgcgctctgggctggggtggtgcccaccgcgtccaccgcgcccgccgccctcggtc
ttctacgtgctggtgtgcggcctgacggtcaccgacttgctgggcaagtgcctcctgagc
cccgtggtgctggctgcctacgctcagaacaggagcctgcgggtgcttgagcccgcattg
gacaactcgctgtgccaaggcttcgccttcttcatgtccttctttgggctctcctcgaca
ctgcaactcctggccatggcactggagtgctggctctccctagggcaccccttcttctac
cgacagcacatcaccctgcgccggggagcgctggtggccccggtggtgagcgccttctgc
ctggctttctgcgccctacctttcgtgggcttcgggaagttcgtgcagtactgccccggg
acctggtgctttatccagatggtccacgaagagggctcactgtcggtgctgggctactct
gtgctctactccagcctcatggcgctgctggtcctcgccaccgtgctgtgcaacctgggc
gccatgcgcaacctctatgaaatgcaccggcggctgcagcggcacccgcgctcctgcacc
agggaccgcaccaaaccccacgccaatgagagggaagcgtcaccgcagcctctggaggag
ctggatcacctcctgctgctggcgctcatgaccgtgctcttcactatgtgttccctgccc
gtaatttatcgtgcttactatggagcatttaaggatgtcaaagagaaaaacaggacctct
gaagaagcagaagacctccaggccttgcgttttctatctgtgatttcaattgtggacccc
tggatttttatcattttcagagctccagtatttcggatgttttttcacaagattttcata
agacctcttaagtacaggaactggtgcagcaattccactaacatggaatccagcctgtga

DBGET integrated database retrieval system