KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040156
Entry
101040156         CDS       T04350                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04020  Calcium signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04144  Endocytosis
sbq04151  PI3K-Akt signaling pathway
sbq04510  Focal adhesion
sbq04540  Gap junction
sbq04630  JAK-STAT signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq05163  Human cytomegalovirus infection
sbq05200  Pathways in cancer
sbq05206  MicroRNAs in cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05230  Central carbon metabolism in cancer
sbq05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101040156 (PDGFRA)
   04014 Ras signaling pathway
    101040156 (PDGFRA)
   04015 Rap1 signaling pathway
    101040156 (PDGFRA)
   04630 JAK-STAT signaling pathway
    101040156 (PDGFRA)
   04020 Calcium signaling pathway
    101040156 (PDGFRA)
   04072 Phospholipase D signaling pathway
    101040156 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    101040156 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101040156 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101040156 (PDGFRA)
   04540 Gap junction
    101040156 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101040156 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101040156 (PDGFRA)
   05206 MicroRNAs in cancer
    101040156 (PDGFRA)
   05230 Central carbon metabolism in cancer
    101040156 (PDGFRA)
   05231 Choline metabolism in cancer
    101040156 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    101040156 (PDGFRA)
   05218 Melanoma
    101040156 (PDGFRA)
   05215 Prostate cancer
    101040156 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101040156 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101040156 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101040156 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:sbq04090]
    101040156 (PDGFRA)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101040156 (PDGFRA)
Protein kinases [BR:sbq01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101040156 (PDGFRA)
CD molecules [BR:sbq04090]
 Proteins
  101040156 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C2-set_2 LAT Kinase-like
Other DBs
NCBI-GeneID: 101040156
NCBI-ProteinID: XP_010342458
LinkDB
Position
Unknown
AA seq 1102 aa
MALFGLHFWFSRAMGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSL
RCFGESEVSWQYPMSEEENSSVEIRNEENNSGLFVTVLEVSNASAAHTGLYTCYYNHTQT
EENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGV
VPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKATSKLDLEMEALKTVYKS
GETIIVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGD
YECAARQATREVKEMKKVTISVHEKGFIEIKPNFSQLEAVNLHEVKNFVVEVQAYPTPRI
SWLKNNLTLIENLTEITTDVEKIQETRYRSQLKLIRAKEEDSGHYTIVVQNEDDVKSYTF
ELLTQVPSSILDLVDDHHGSTGGQTVRCMAEGTPLPDIEWMICKDIKKCNNETSWTILAN
NVSNIITEVHPRGRSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTV
AAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWE
FPRDGLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKI
MTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDI
FGLNPADESTRSYVILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPAS
YKKKSMLDSEVKNLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLA
QGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWE
IFSLGGTPYPGMMVDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLS
EIVENLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDSDNAYVGVTYKNEEDKLKDWEGGL
DEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETI
EDIDMMDDIGIDSSDLVEDSFL
NT seq 3309 nt   +upstreamnt  +downstreamnt
atggcactatttggacttcacttctggttttccagagctatggggacttcccatccggcg
ttcctggtcttaggctgtcttcttacagggctgagcctaatcctctgccagctttcatta
ccctctatccttccaaatgaaaatgaaaaggttgtgcagctgaattcatccttttctctg
agatgctttggggagagtgaagtgagctggcagtaccccatgtctgaagaagagaactcc
agtgtggaaatcagaaatgaggaaaacaacagtggcctttttgtgacggtcttggaagtg
agcaatgcctcggcagcccacacagggctgtacacttgctattacaaccacactcagaca
gaagagaatgagcttgaaggcaggcacatttacatctatgtgccagacccagatgttgcc
tttgtacctctaggaatgacggattatttagtcattgtggaggacgatgattctgccatc
ataccttgtcgcaccactgatcctgagactcctgtaaccttacacaacagcgagggggtg
gtacctgcctcctacgacagcagacagggctttaatgggaccttcactgtcgggccctat
atctgtgaggccaccgtcaaaggaaaaaagttccagaccatcccttttaatgtttatgct
ttaaaagcaacatcaaagctggatctagaaatggaagctcttaaaactgtgtataagtca
ggggaaacgattatagtcacctgtgctgtttttaacaatgaggtggttgaccttcagtgg
acttaccctggagaagtgaaaggcaaaggcatcacaatgcttgaagaaatcaaagtccca
tccatcaaattggtgtacactttgacggtccccgaggccacggtgaaagacagtggagat
tacgaatgtgctgcccgccaggctaccagggaggtcaaagaaatgaagaaagtcactatt
tctgtccatgagaaaggcttcattgagatcaaacccaacttcagccagttggaagctgtc
aacctgcatgaagtcaaaaattttgtcgtagaggtacaggcctacccaactcccaggata
tcctggctgaaaaacaacctgactctgatcgaaaatctcaccgagatcaccactgatgtg
gaaaagattcaggaaacaaggtatcgaagccaattaaagctgatccgtgctaaggaagaa
gacagtggccattatactattgtagttcaaaatgaagatgatgtgaagagctatactttt
gaactgttaactcaagttccttcatccattctggacttggttgatgatcaccatggctca
actgggggtcagacagtgaggtgcatggctgaaggcacaccgcttcctgatattgagtgg
atgatttgcaaggatattaagaaatgtaataatgaaacttcgtggacgattttggccaac
aatgtctcaaacatcatcacggaggtccatccccgaggcaggagtaccgtggagggccgt
gtgactttcgccaaagtggaggagaccattgcggtgcgatgcctggctaagaatctcctt
ggtgctgagaaccgagagctgaagctcgtagctcccaccctgcgttctgaactcacggtg
gctgctgcggtcctggtgctgttggtgattgtgatcatctcactcattgttctggtcgtc
atttggaaacagaaaccgaggtatgaaattcgctggagggtcattgaatcaatcagccct
gatggacatgaatatatttatgtggacccgatgcagctgccttatgactcaagatgggag
tttccaagagatggactagtgcttggtcgggtgttggggtctggagcgtttgggaaggtg
gttgaaggaacagcctatggactgagccgatcccagcctgtcatgaaggttgccgtgaag
atgttaaagcccacagccagatccagtgaaaaacaagctctcatgtctgaactgaagata
atgactcacctggggccacatttgaacattgtaaacttgctgggagcctgcaccaagtca
ggccccatctacatcatcacagagtactgcttctatggagatttggtaaactatttgcat
aagaatcgggatagcttcctgagccaccacccagagaagccaaagaaagagctggatatc
tttggattgaaccctgctgatgaaagcacacggagctatgttattttgtcttttgaaaac
aatggtgactacatggatatgaagcaagctgatactacacagtatgtccccatgctggaa
aggaaagaagtttctaaatattccgacatccagagatcactctatgatcgtccagcctca
tataagaagaaatccatgttagactcagaagtcaaaaacctcctttcagatgataactca
gaaggccttactctgttggatttgttgagcttcacctatcaagttgcccgaggaatggag
tttttggcctcaaaaaattgtgtccaccgggatctggctgctcgtaatgtcctcctggca
caaggaaaaatcgtgaagatctgtgactttggcctggccagagacatcatgcatgactcg
aactacgtgtcaaaaggcagcacctttctgcctgtgaagtggatggctcctgagagcatc
tttgacaacctctacaccacactgagtgacgtctggtcttacggcattctgctctgggag
atcttttcccttggtggcaccccttaccctggcatgatggtggattctactttctacaat
aagatcaagagtggataccggatggccaagcctgaccacgctaccagtgaagtctatgag
atcatggtgaaatgctggaacagtgagccggaaaagagaccctccttttaccacctgagt
gagattgtagagaatctgctgcctggacaatataaaaagagttacgaaaaaattcacctg
gacttcctgaagagtgaccatcctgccgtggcacgcatgcgtgtggactcagacaacgcg
tacgttggtgtcacctacaaaaacgaggaagacaagctgaaggactgggagggtggcctg
gatgagcagaggctgagcgctgacagtggctacatcattcctctgcctgacatcgaccct
gtccccgaggaggaggacctgggcaagaggaacagacacagctcgcagacctctgaagag
agtgccattgagacgggttccagcagttccaccttcatcaagagagaggacgagaccatt
gaagacatcgacatgatggacgacatcggcatagactcttcagacctggtggaagacagc
ttcctgtaa

DBGET integrated database retrieval system