KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040202
Entry
101040202         CDS       T04350                                 

Gene name
APOA5
Definition
(RefSeq) apolipoprotein A-V
  KO
K09025  apolipoprotein A-V
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101040202 (APOA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101040202 (APOA5)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Heparin
  Others
   101040202 (APOA5)
SSDB
Motif
Pfam: Apolipoprotein ApoLp-III Exonuc_VII_L TraC_F_IV BcrAD_BadFG YtxH DUF4456 ACP_PD
Other DBs
NCBI-GeneID: 101040202
NCBI-ProteinID: XP_010332822
UniProt: A0A2K6UYL4
LinkDB
Position
Unknown
AA seq 366 aa
MASMAAVLTWALALLSAFSATQARKGFWDYFRQTSGDKGKMEQIHQQKMAREPASLKDSL
EQDLNNMNKFLEKLGPLSGSEAPRLPRDPVGMRQQLQEELEEVRARLQPYMAEAHELVGW
NLEGLRQQLKPYTMDLMEQVALRVQELQEKLRVVGEDTKAQLLGGVGEARALLQELQSRV
VQHTGRFKELFHPYAESLVSGIGRHVQELHRSVAPHAPASPARLSRCVQVLSRKLTLKAK
ALHARIQQNLDQLREELSRAFAGTGAEQGAGPDPEMLSEEVRQKLEAFRQDTYLQIAAFT
RAIDQETEEVQQQLAPPPPGHSAFAPEFGQMDSDKALSKLQARLDDLWEDIAYSLHDQGH
SHLEEP
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggcaagcatggctgccgtgctcacctgggctctggctctcctctcagcgttttcggcc
acccaggcacggaaaggcttctgggactacttccgccagaccagtggggacaaaggcaag
atggagcagatccatcagcagaagatggctcgtgagcccgcgagcctgaaagacagcctt
gagcaagacctcaacaatatgaacaagttcctggaaaagctggggcctctgagtgggagc
gaggctcctcggctcccacgggacccggtgggcatgcggcagcagctgcaggaggagttg
gaggaggtgagggcgcgcctgcagccctacatggcagaggcgcacgagctggtgggctgg
aatttggagggcttgcggcagcagctgaagccctacacgatggatctgatggaacaggtg
gccctgcgcgtgcaggagctgcaggagaagttgcgcgtggtgggagaagataccaaggcc
cagctgctggggggcgtgggcgaggcgcgggctttgctgcaggaactgcagagccgcgtg
gtgcaacataccggccgtttcaaagagctcttccacccgtacgccgagagcctggtgagc
ggcattgggcgccacgtgcaggaactgcaccgcagtgtggctccgcacgcccccgccagc
cccgcgcgcctcagccgctgcgtgcaggtgctctcccgcaaactcacactcaaggccaag
gctttgcacgcacgcatccaacagaacctggaccagctgcgcgaagagcttagccgcgcc
tttgcaggcactggggctgagcagggggccggcccggacccggagatgctctccgaggag
gtgcgtcagaaactcgaggctttccgccaggacacctacctgcagatcgctgccttcact
cgtgccatcgaccaggagactgaggaagtccagcagcagctggcaccacctccaccaggc
cacagcgccttcgccccagagtttggacaaatggacagtgacaaggccctgagcaagctg
caggcccgtctggatgacctgtgggaagacatcgcctacagccttcatgaccagggccac
agccatctggaggagccctga

DBGET integrated database retrieval system