KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040247
Entry
101040247         CDS       T04350                                 

Gene name
RXRG
Definition
(RefSeq) retinoic acid receptor RXR-gamma isoform X1
  KO
K08526  retinoid X receptor gamma
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04659  Th17 cell differentiation
sbq04919  Thyroid hormone signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05216  Thyroid cancer
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101040247 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101040247 (RXRG)
   03320 PPAR signaling pathway
    101040247 (RXRG)
   04919 Thyroid hormone signaling pathway
    101040247 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    101040247 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101040247 (RXRG)
   05202 Transcriptional misregulation in cancer
    101040247 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    101040247 (RXRG)
   05216 Thyroid cancer
    101040247 (RXRG)
   05222 Small cell lung cancer
    101040247 (RXRG)
   05223 Non-small cell lung cancer
    101040247 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101040247 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:sbq03310]
    101040247 (RXRG)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    101040247 (RXRG)
Nuclear receptors [BR:sbq03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   101040247 (RXRG)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 101040247
NCBI-ProteinID: XP_003928117
UniProt: A0A2K6TB21
LinkDB
Position
Unknown
AA seq 463 aa
MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPTGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLAGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERIL
EAELAVEPKTESCGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtatggaaattattctcacttcatgaagtttcccgcaggctatggaggctcccctggc
cacactggctctacatccatgagcccatcggcagccttgtccacggggaaaccaatggac
agccaccccagctacacggacaccccagtgagtgccccacggactctgagtgcagtgggg
acccccctcaatgccctgggctctccatatcgagtcatcacctctgccatgggcccaccc
acaggagcgctggcagcccctccaggaatcaacctggtggccccacctagctctcagcta
aatgtggtcaacagtgtcagcagttcagaggacatcaagcccttagcagggcttcccggg
attggaaacatgaactacccgtccaccagccctggatcgctggttaaacacatctgtgcc
atctgtggagacagatcctcaggaaagcactatggggtgtacagttgtgaaggctgcaaa
gggttcttcaagaggacgataaggaaggacctcatctacacatgtcgggataataaagat
tgcctcattgacaagcgtcagcgcaaccgctgccagtactgtcgctatcagaagtgcctt
gtcatgggcatgaagagggaagctgtgcaagaagaaagacagaggagccgggagcgagct
gagagtgaggcagaatgtgccagtagtggtcatgaagacatgcccgtggagaggattcta
gaagctgaacttgctgttgaaccaaagacagaatcctgtggtgacatgaacatggagaac
tcgacaaatgaccctgttaccaacatatgtcatgcggctgacaagcagcttttcaccctc
gttgaatgggccaagcgtattccccacttctctgacctcaccttggaggaccaggtcatt
ctgcttcgggcagggtggaatgaattgctgattgcctctttctcccaccgctcagtttcc
gtgcaggatggcatccttctggccacgggtttacatgtccaccggagcagtgcccatagt
gctggggtcggctccatctttgacagagttctaactgagctggtttccaaaatgaaagac
atgcagatggacaagtcggagctggggtgcctgcgagccattgtgctctttaacccagat
gccaagggcctctccaacccctctgaggtggagactctgcgagagaaggtttatgccacc
ctcgaggcctacaccaagcagaagtatccggaacagccaggcaggtttgctaagctgctg
ctgcgcctcccagctctgcgctccattggcttgaaatgcctggagcacctcttcttcttc
aagctcatcggggacacccccattgacaccttcctcatggagatgttggagaccccactg
cagatcacctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040304
Entry
101040304         CDS       T04350                                 

Gene name
RXRB
Definition
(RefSeq) retinoic acid receptor RXR-beta isoform X1
  KO
K08525  retinoid X receptor beta
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04659  Th17 cell differentiation
sbq04919  Thyroid hormone signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05216  Thyroid cancer
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101040304 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101040304 (RXRB)
   03320 PPAR signaling pathway
    101040304 (RXRB)
   04919 Thyroid hormone signaling pathway
    101040304 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    101040304 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101040304 (RXRB)
   05202 Transcriptional misregulation in cancer
    101040304 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    101040304 (RXRB)
   05216 Thyroid cancer
    101040304 (RXRB)
   05222 Small cell lung cancer
    101040304 (RXRB)
   05223 Non-small cell lung cancer
    101040304 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101040304 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:sbq03310]
    101040304 (RXRB)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    101040304 (RXRB)
Nuclear receptors [BR:sbq03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   101040304 (RXRB)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 101040304
NCBI-ProteinID: XP_010332314
LinkDB
Position
Unknown
AA seq 401 aa
MISITSTRFSFPMSLPVTSLFPSSQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPG
GPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNR
CQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGTGGAPEEMPVDRILEAELAVEQKSD
QGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLRAGW
NELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRSLSRVLTELVSKMRDMR
MDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLR
LPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgatttccatcacttctactagattctccttcccaatgagtcttcctgtgacttcccta
tttccctcatcccagattaactcaacagtgtcgctccctgggggtgggtctggcccccct
gaagatgtgaagccaccagtattaggggtccggggcctgcactgtccaccccctccaggt
ggcccgggggctggcaaacggctatgtgcaatctgcggggacagaagctcaggtaaacac
tacggggtttacagctgtgagggttgcaagggcttcttcaaacgcaccatccgcaaggac
cttacgtactcttgccgggacaacaaagactgcacagtagacaagcgccaacggaaccgc
tgtcagtactgccgctatcagaagtgcctggccactggcatgaagagggaggcggtacag
gaggagcgccagcggggaaaggacaaggatggggatggggaggggactgggggagcccct
gaggagatgcctgtggacaggatcctggaggcagagcttgctgtggagcagaagagtgac
cagggcgttgagggtcctgggggaaccgggggtagcggcagcagcccaaatgaccccgtg
actaacatctgtcaggcagctgacaaacagctattcacgcttgttgagtgggcgaagagg
atcccacacttttcctccttgcctctggatgatcaggtcatattgctgcgggcaggctgg
aatgaactcctcattgcttccttctcccaccgatccattgatgttcgagatggcatcctc
cttgccacaggtcttcatgtgcaccgcaactcagcccattcagcaggagtaggagccatc
tttgatcggtccctctccagggtgctgacagagctagtgtccaaaatgcgtgacatgagg
atggacaagacagagcttggctgcctgagggcaatcattctgtttaatccagatgccaag
ggcctctccaaccctagcgaggtggaggtcctgcgggagaaagtgtatgcgtcactggag
acctactgcaaacagaagtaccctgagcagcagggacggtttgccaagctgctgctacgt
cttcctgccctccggtccatcggccttaagtgtctagagcatctgtttttcttcaagctc
attggtgacacccccatcgacacttttcttatggagatgcttgaggctccccatcaactg
gcctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044148
Entry
101044148         CDS       T04350                                 

Gene name
RXRA
Definition
(RefSeq) retinoic acid receptor RXR-alpha
  KO
K08524  retinoid X receptor alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04659  Th17 cell differentiation
sbq04919  Thyroid hormone signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04932  Non-alcoholic fatty liver disease
sbq04976  Bile secretion
sbq05160  Hepatitis C
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05216  Thyroid cancer
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101044148 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101044148 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101044148 (RXRA)
   03320 PPAR signaling pathway
    101044148 (RXRA)
   04919 Thyroid hormone signaling pathway
    101044148 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    101044148 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    101044148 (RXRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101044148 (RXRA)
   05202 Transcriptional misregulation in cancer
    101044148 (RXRA)
  09162 Cancer: specific types
   05226 Gastric cancer
    101044148 (RXRA)
   05216 Thyroid cancer
    101044148 (RXRA)
   05222 Small cell lung cancer
    101044148 (RXRA)
   05223 Non-small cell lung cancer
    101044148 (RXRA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101044148 (RXRA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101044148 (RXRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101044148 (RXRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:sbq03310]
    101044148 (RXRA)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    101044148 (RXRA)
Nuclear receptors [BR:sbq03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   101044148 (RXRA)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 101044148
NCBI-ProteinID: XP_010350504
LinkDB
Position
Unknown
AA seq 435 aa
MAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPATPTLGF
STGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHY
GVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQE
ERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANVGLNPSSPNDPVTN
ICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLA
TGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPA
EVEALREKVYASLEAYCKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPI
DTFLMEMLEAPHQMT
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggccgccccctcgctgcacccgtccctggggcctggcatcggctccccagggcagctg
cactcccccatcagcaccctgagctcccccatcaatggcatgggcccacccttctccgtc
atcagttcccccatgggcccgcactccatgtcggtgcccgccacacccaccctgggcttc
agcactggcagcccccagctcagctcacccatgaaccccgtcagcagcagcgaggacatc
aagcctcccctgggcctcaatggcgtcctcaaggtccccgcccatccctcaggaaacatg
gcatccttcaccaagcacatctgcgccatctgcggggaccgctcctcaggcaagcactac
ggcgtgtatagctgtgagggctgcaagggcttcttcaagcggacggtgcgcaaggacctg
acctacacctgccgggacaacaaggactgcctgattgacaagcggcagcggaaccggtgc
cagtactgccgctaccagaagtgcctggccatgggcatgaagcgggaagccgtgcaggag
gagcggcagcgaggcaaggaccggaacgagaacgaggtggagtcgaccagcagtgccaac
gaggacatgcccgtggagaggatcctggaggccgagctggctgtggagcccaagaccgag
acctacgtggaggccaacgtggggctgaaccccagctcgccgaacgaccccgtcaccaac
atctgccaggcagccgacaagcagctgttcaccctggtggagtgggccaagcgcatcccg
catttctcagagctgcccctggacgaccaggtcatcctgctgcgggcaggctggaacgag
ctgctcatcgcctccttctcccaccgctccatcgccgtgaaggacgggatcctcctggcc
accgggctgcacgtccaccggaacagcgcccacagcgcaggggtgggcgccatctttgac
agggtgctgacggagctcgtgtccaagatgcgggacatgcagatggacaagacggagctg
ggctgcctgcgtgccatcgtcctcttcaaccccgactccaaggggctctcgaacccggcc
gaggtggaggcgctgagggagaaggtctatgcgtccctggaggcctactgcaagcagaag
tacccagagcagccgggaaggttcgccaagctcctgctccgcctgccggctctgcgctcc
attgggctcaagtgcctggaacatctcttcttcttcaagctcatcggagacacgcccatt
gacaccttcctcatggagatgctggaggccccacaccaaatgacttag

DBGET integrated database retrieval system