KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040331
Entry
101040331         CDS       T04350                                 

Gene name
BID
Definition
(RefSeq) BH3-interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01524  Platinum drug resistance
sbq04071  Sphingolipid signaling pathway
sbq04115  p53 signaling pathway
sbq04210  Apoptosis
sbq04215  Apoptosis - multiple species
sbq04217  Necroptosis
sbq04650  Natural killer cell mediated cytotoxicity
sbq04932  Non-alcoholic fatty liver disease
sbq05010  Alzheimer disease
sbq05014  Amyotrophic lateral sclerosis
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    101040331 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101040331 (BID)
   04215 Apoptosis - multiple species
    101040331 (BID)
   04217 Necroptosis
    101040331 (BID)
   04115 p53 signaling pathway
    101040331 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101040331 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101040331 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101040331 (BID)
   05014 Amyotrophic lateral sclerosis
    101040331 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    101040331 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101040331 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101040331 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101040331 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101040331 (BID)
   05161 Hepatitis B
    101040331 (BID)
   05160 Hepatitis C
    101040331 (BID)
   05164 Influenza A
    101040331 (BID)
   05162 Measles
    101040331 (BID)
   05168 Herpes simplex virus 1 infection
    101040331 (BID)
   05163 Human cytomegalovirus infection
    101040331 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101040331 (BID)
   05169 Epstein-Barr virus infection
    101040331 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101040331 (BID)
SSDB
Motif
Pfam: BID Bcl-2 HrpJ
Other DBs
NCBI-GeneID: 101040331
NCBI-ProteinID: XP_010328866
LinkDB
Position
Unknown
AA seq 285 aa
MDREVSNGSGLQDERITNLLVFGFLQSCSNHSFQAELEALGRELPHWEEPDEELQTDGNR
GSHAHMGRIEADSESQEDIIRNIARQLAQVGDSMDRSIPPGLVNRLALQLRNAGRSEEDQ
RRDLASALEQLLQVHPMDMDKEKTMLVLALLLAKEVANHTPSLLRDVFRTTVNFINQNLR
AYVRSLARNVRDGLNGRFRKRDWPQPGRCFSAEPPVGPKGPMSATVYKVRQLTALYPFSL
REVKALLKKLLRCPGSSLVPAANFQLLATCWARHAPEAQLERPGS
NT seq 858 nt   +upstreamnt  +downstreamnt
atggaccgcgaggtcagcaatgggtccggcctccaggatgagcgcatcacaaacctgctg
gtgtttggcttcctccaaagctgctccaaccacagcttccaggcagagctggaggcgctg
ggccgcgagctgccgcactgggaggagccggatgaagagctgcagacggacggcaaccgc
ggcagccacgcccacatggggagaatcgaggcagattctgaaagtcaagaagacatcatc
cggaacattgccaggcagctcgcccaggttggggacagcatggaccgcagcatccccccg
ggtctggtgaaccgcctggccctgcagctcaggaacgccggccggtcggaggaggaccag
aggagggacctggccagtgccctggagcagctgctgcaggtccacccaatggacatggac
aaggagaagaccatgctggtgctggccctgctgctggccaaggaggtggccaatcacacg
ccgtccttgctccgtgatgtcttccgcacaacagtgaatttcattaaccagaacctacgt
gcctatgtgaggagcttagccagaaacgtaagagacggactgaatggacggttccgaaag
cgtgactggccacagccaggtcgctgcttcagtgcagaaccacctgtgggtccgaaaggg
cctatgtcagccactgtttacaaagtcaggcagctgactgcactgtaccccttctctctc
cgtgaagtcaaggctttgctaaagaagctcctgcgatgccccgggagcagcctggtccca
gctgcaaacttccagcttctggccacgtgctgggctcgccatgcccccgaagcgcagctg
gagagaccaggttcctaa

DBGET integrated database retrieval system