KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040358Help
Entry
101040358         CDS       T04350                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sbq01002]
    101040358 (TMPRSS9)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101040358 (TMPRSS9)
Peptidases [BR:sbq01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101040358 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 101040358
NCBI-ProteinID: XP_010337722
LinkDB All DBs
Position
Unknown
AA seq 749 aa AA seqDB search
MESAVADVHLMPRTTKEVPAPDAACCRAVTVGVVATSLVVLTLGVVLAFLSMQGVHVDHT
AQVRGIRWASSLRQEASDYHRTLTPTLEALLHFLLQPLQTLSLGLEEEILQEGIRARLRE
QGISLAAYGTIVSAELTGEWAVETESTSRGGWRRAAVTRYILIITSSHKKKMKQSAQRLM
PVIPAGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEAQRPGVYARVTRLRDWILEATTTTG
PTPALTAAPVPAAPSTAWPTSPQSSVVNSPTKSTPAPGTAALGWVTVPKLQECGARPAME
KPPRIVGGFAADSGEVPWQVSLKEGARHFCGATVVGDRWLLSAAHCFNHTKVEQVRAHLG
TASLLGLGGSPAKVGLRRVVPHPLYNPGILDFDLAVLELASPLAFNKYIQPVCLPLAIQK
FPVGRKCMISGWGNTQEGNATKPELLQKASVGIIDQKTCSVLYNFSLTDRMLCAGFLEGR
VDSCQGDSGGPLACEETPGVFYLAGIVSWGIGCAQVKKPGVYTRITRLKGWILETMASQP
HLVSPPSTTRMLATTSHLPRTAGLMVLGATPSQPTPVATSRVTGQPANSTLSAVSTTFGG
QTPLPDTAEATTHSQLPDCGLAPAALTRIVGGSAAGRGEWPWQVSLWLRRREHRCGAVLV
AERWLLSAAHCFDVISGRMLCAGFPQGGVDSCSPQQGDAGGPLACREPSGRWVLTGVTSW
GYGCGRPHFPGVYTRVAAVRGWIGQHIQE
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgccgtggctgacgtacacctcatgcccaggacaaccaaggaggtccctgct
ccggacgccgcgtgctgtcgagcggtcaccgttggcgtggtggccaccagccttgtcgtc
ctcaccctgggagtcgttttggccttcctctctatgcagggtgtccacgtggaccacaca
gcccaggttcggggcatccgatgggccagcagtctgcggcaggaggcctcggactatcac
cgcacgctgacgcccaccctggaggcactgctgcattttctgctgcaacccctccagacg
ttgagcctgggcctggaggaggagatactgcaggaaggaatccgggcaaggctgcgggag
caaggcatctccctggctgcctacggcaccattgtgtcggctgagctcacaggtgagtgg
gcagttgagactgaatccacatcacgaggaggctggaggcgggcagctgtcacaagatac
attttgataatcacctcttcccataaaaagaaaatgaaacagtcagcgcagcggctcatg
cctgtgatcccagcaggcgactcaggaggacccctggtgtgcgaggaaccctctggcagg
ttctttctggctggcatcgtgagctggggcatcggctgtgcggaagcgcaacgtcccggg
gtctatgcccgagtcaccaggctgcgtgactggatcctggaggccaccaccacaaccggc
ccgactccggccctcacggcggctcctgtccccgctgcccccagcacggcctggcccacc
agtccccagagctccgtggtcaacagccccaccaaatccacgccggcccccggcaccgcg
gctcttggctgggtcaccgtgccaaagctacaagaatgcggggccaggcctgcgatggag
aagcccccccggatcgtgggcgggttcgcagcggactctggggaagtgccctggcaggtc
agcctgaaggaaggggcccggcacttctgcggagcaaccgtggtgggcgaccgctggctg
ctgtctgccgctcactgcttcaaccacacgaaggtggagcaggtccgggcccacctgggc
accgcgtccctcctggggctgggcgggagcccggcgaaggtcgggctgcggcgggtggtg
ccgcaccccctctacaaccctggcatcctggacttcgacctggccgtcctggagctggcc
agccccctggccttcaacaagtacatccagcccgtctgcctgcccctggccatccagaag
tttcccgtgggccggaagtgcatgatctccggatggggaaacacgcaggaaggaaacgcc
accaagcccgagctcctgcagaaggcgtctgtggggatcatagaccagaaaacctgcagc
gtgctctacaacttctccctcaccgaccgcatgctctgcgcgggcttcctggaagggaga
gtcgactcctgccagggcgactccgggggccccctggcctgcgaggagacccccggcgtg
ttttatctggcggggatcgtgagctgggggattggctgcgctcaagttaagaagcctggc
gtgtacacgcgcatcacgaggctgaagggctggattctggagaccatggcctcccagccc
catctcgtctccccgccctcgaccacaaggatgctggccaccaccagccatctccccagg
acagctggcctcatggtcctgggggccacccccagccaacccacccctgtggccaccagc
agagtgaccggccaacctgccaactcaaccttatctgccgtgagcaccacctttggggga
cagacgccacttccagacaccgcagaggccaccacccactcccagctaccagactgcggc
ctggcgccggcggcgctcaccaggattgtggggggcagcgcggcgggccgcggggagtgg
ccgtggcaggtgagcctgtggctgcggcgccgggagcaccgctgtggggccgtgctggtg
gcagagaggtggctgctgtctgcggcgcactgcttcgacgtgatcagcggccgcatgctg
tgcgctggcttcccgcagggaggcgtggacagctgctcgccccaacagggtgacgctggg
ggacccctggcctgcagggagccctctggacggtgggtgctaactggggtcaccagctgg
ggctatggctgtggccggccccacttcccaggtgtctacacccgggtggcagctgtgaga
ggctggataggacagcacatccaggagtga

DBGET integrated database retrieval system