KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040767
Entry
101040767         CDS       T04350                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04110  Cell cycle
sbq04115  p53 signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04218  Cellular senescence
sbq04530  Tight junction
sbq04660  T cell receptor signaling pathway
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04934  Cushing syndrome
sbq05160  Hepatitis C
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05212  Pancreatic cancer
sbq05214  Glioma
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05220  Chronic myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101040767 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101040767 (CDK4)
   04115 p53 signaling pathway
    101040767 (CDK4)
   04218 Cellular senescence
    101040767 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101040767 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101040767 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101040767 (CDK4)
   05203 Viral carcinogenesis
    101040767 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101040767 (CDK4)
   05225 Hepatocellular carcinoma
    101040767 (CDK4)
   05214 Glioma
    101040767 (CDK4)
   05220 Chronic myeloid leukemia
    101040767 (CDK4)
   05218 Melanoma
    101040767 (CDK4)
   05219 Bladder cancer
    101040767 (CDK4)
   05224 Breast cancer
    101040767 (CDK4)
   05222 Small cell lung cancer
    101040767 (CDK4)
   05223 Non-small cell lung cancer
    101040767 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101040767 (CDK4)
   04934 Cushing syndrome
    101040767 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101040767 (CDK4)
   05160 Hepatitis C
    101040767 (CDK4)
   05164 Influenza A
    101040767 (CDK4)
   05162 Measles
    101040767 (CDK4)
   05163 Human cytomegalovirus infection
    101040767 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101040767 (CDK4)
   05169 Epstein-Barr virus infection
    101040767 (CDK4)
   05165 Human papillomavirus infection
    101040767 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101040767 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101040767 (CDK4)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101040767 (CDK4)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: CMGC group
  CDK family
   101040767 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 101040767
NCBI-ProteinID: XP_003926545
UniProt: A0A2K6V2B6
LinkDB
Position
Unknown
AA seq 302 aa
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAGGGLPVSTVREVALLR
RLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLM
RQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYR
APEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRD
VSLPRGAFHPRGPRPVQSVVPEMEELGAHLLLEMLTFNPHKRISAFRALQHSYLHKDEGN
QE
NT seq 909 nt   +upstreamnt  +downstreamnt
atggctacctctcgatatgagccagtggctgaaattggtgtcggtgcctatgggacagtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtcccc
aatggaggagctggaggaggccttcccgtcagcacagttcgtgaagtggctttactgagg
cgactggaggcttttgagcatcccaacgtagtccggctgatggatgtctgtgccacatcc
cgaactgaccgagagatcaaggtaaccctggtgtttgagcatgtagaccaagatctaagg
acgtatctggacaaggcacccccaccaggcttgccagctgagaccatcaaggatctgatg
cgccagtttctaagaggcctagattttcttcatgccaattgcatcgttcaccgagatctg
aagccagagaacattctggtgacaagtggtggaacagtcaagctggctgactttggcctg
gcgagaatctacagctaccagatggcacttacacccgtggttgttacactctggtaccga
gctcccgaagttcttctgcagtccacatatgcaacacctgtggacatgtggagtgttggc
tgtatctttgctgagatgtttcgtcgaaagcctctcttctgcggaaactctgaagctgac
cagttgggcaaaatctttgacctgattgggctgcctccagaggatgactggcctcgagat
gtatctctgccccgtggagcctttcacccccgagggccccgcccagtgcagtcggtggta
cccgagatggaggagttgggagcacatctgctgctggaaatgctgacttttaacccacac
aagcgaatctctgcctttcgagctctgcagcactcttatctacataaggatgaaggtaat
caagagtga

DBGET integrated database retrieval system