KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040811Help
Entry
101040811         CDS       T04350                                 

Gene name
ADRA1B
Definition
(RefSeq) alpha-1B adrenergic receptor
  KO
K04136  adrenergic receptor alpha-1B
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04020  Calcium signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04080  Neuroactive ligand-receptor interaction
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04270  Vascular smooth muscle contraction
sbq04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101040811 (ADRA1B)
   04022 cGMP-PKG signaling pathway
    101040811 (ADRA1B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101040811 (ADRA1B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101040811 (ADRA1B)
   04270 Vascular smooth muscle contraction
    101040811 (ADRA1B)
  09154 Digestive system
   04970 Salivary secretion
    101040811 (ADRA1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sbq04030]
    101040811 (ADRA1B)
G protein-coupled receptors [BR:sbq04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    101040811 (ADRA1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srv Shisa Prominin
Motif
Other DBs
NCBI-GeneID: 101040811
NCBI-ProteinID: XP_010343675
LinkDB All DBs
Position
Unknown
AA seq 339 aa AA seqDB search
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGKLGTSRRGTGHFWTLGLLMSLL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccgatctggacaccggccacaacacatcagcacctgcccactggggagagttg
aaaaatgccaacttcactggccccaaccagacctcgagcaactccacactgccccagctg
gacatcaccagggccatctctgtgggcctggtgctgggcgccttcatcctctttgccatc
gtgggcaacatcctagtcatcttgtctgtggcctgcaaccggcacctgcggacgcccacc
aactacttcatcgtcaacctggccatggccgacctgctgctgagcttcaccgtcctgccc
ttctcggcggccctggaggtgctgggctactgggtgctggggcggatcttctgtgacatt
tgggcagccgtggatgtcctgtgctgcacagcgtccattctgagcctgtgcgccatctcc
atcgatcgctacatcggggtgcgctactctctgcagtaccccacgctggtcacccggagg
aaggccatcttggcgctgctcagtgtctgggtcctgtccaccgtcatctccatcgggcct
ctccttgggtggaaggagccggcgcccaacgatgacaaggagtgcggggtcaccgaagaa
cccttctacgccctcttctcctccctgggctccttctacatccctctggcggtcattctg
gtcatgtactgccgtgtctacatcgtggccaagagaaccaccaagaacctggaggcggga
gtcatgaaggagatgtccaactccaaggagctgaccctgaggatccactccaagaacttt
cacgaggacaccctcagcagtaccaaggccaagggccacaaccccaggagttccatagct
gtcaaactttttaagttctccagggaaaagaaagcagccaagacgctgggcattgtggtc
ggtatgttcatcttgtgctggctacccttcttcatcgctctgccacttggtaagttgggg
actagcaggaggggaactgggcatttttggaccttgggtttactgatgagcttactctaa

DBGET integrated database retrieval system