KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040860
Entry
101040860         CDS       T04350                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X2
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04020  Calcium signaling pathway
sbq04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101040860 (CACNA1E)
   04020 Calcium signaling pathway
    101040860 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101040860 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sbq04040]
    101040860 (CACNA1E)
Ion channels [BR:sbq04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101040860 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 101040860
NCBI-ProteinID: XP_003925363
LinkDB
Position
Unknown
AA seq 2394 aa
MLPASPRAASGFDNFFPVQEGEGPGWEGAVALEAGSGPFLPVSPEVMKRRRGGLIEQRDI
IKAHEAHKMQSTPQARRKEWEMARFGEAVVARPGSGDGDSDQSRNRQGTPVPASGQAAAY
KQTKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEENIVRKYAKKLIDWPPFEYMILATI
IANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNG
WNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMV
PLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYEC
KDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGS
FFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEEN
KNTGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGVSYFR
HKERLLRISIRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLF
LLEMSLKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRI
FKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSAN
FDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFL
AIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMW
EPRSSHLRERRRRHHMSVWEQRTSQLRKHMQMSSQEALNREEASSMNPLNPLHPLSPLSA
LNAHPSLYRRPRAIEGLALGLALEKFDEERISRGGSLKGEGGDRSGALDNQRTPLSLGQR
ELPWLARSCHGNCDPTQQEAGVGEAVVTFEDRARHRQSQRRSRHRRVRTEGKESSSASRS
RSASQERSLDEAMPAEGEKEHELRGSHGAKEPTIQEERAQDLRRTNSLMLSRGSGLAGAL
DEANTPLVLPHPELEVGKDAVLTEQEPEGSSEQALLGDVQLDMGRVISHSEPDLSCITAN
TDKATTESTSVTVAIPDVGPLVDSTVVHISNKTDGEASPLKEAEIREDEEEVENTKQKKE
KRETGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTN
SERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFAL
ANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLF
MFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNII
WALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFV
ALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPS
FEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFR
DTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWT
FVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRS
ATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFV
AVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGK
RCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKET
LAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMF
QRMEPSSLPQEIIANAKALPYLQQDPVSGLSGRTGYPSMSPLSPQEIFQLACMDPADDGQ
FQEQQSLEPEVSELKSVQPSNQGIYLPSDTQEHAGSGRASSMPRLTVDPQVVTDPSSMRR
SFSTIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSG
GRERGRSKERKHLLSPDVSRCNSEERGTQADWESPERRPSRSPSEGRSQTPNRQGTGSLS
ESSIPSVSDTSTPRRSRRQLPPVPPKPRPLLSYSSLIRHAGSISPPADGSQEGSPLTSQA
LESNSACLTESSNSPHPQQGHHISPQRYISEPYLAQHEDSHASDCGEEETLTFEAAVATS
LGRSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGLMCGAVNNLLSDTEEDDKC
NT seq 7185 nt   +upstreamnt  +downstreamnt
atgctgccggcctccccgcgtgccgcctccggcttcgacaacttcttcccggtgcaggag
ggcgagggcccgggctgggagggcgctgtggcgctggaagcgggctccggccccttcctc
ccggtgagccccgaggtcatgaagcggcggcgcgggggcctcatcgaacagcgcgacatc
atcaaggcccacgaggcgcacaagatgcagagcaccccgcaggcccggcgcaaggaatgg
gagatggctcgcttcggggaggcggtggtcgccaggccggggtcgggcgatggagactcg
gaccagagcagaaaccggcaaggaacccccgtgccggcctcggggcaggcggcagcctac
aagcagacgaaagcgcagagggcgcggactatggctttgtacaaccccattcccgtccgg
cagaactgtttcaccgtcaacagatccctgttcatcttcggagaagaaaacattgtcagg
aaatacgccaagaagctcatcgattggccgccgtttgagtacatgattctggccaccatc
atcgccaactgcatagtcctggctctggagcagcatcttcctgaggacgacaagaccccc
atgtcccgaaggctggagaagacagaaccttatttcattgggatattttgctttgaagct
gggatcaagattgtggccctggggttcatcttccataagggctcgtacctccgcaatggc
tggaatgtcatggacttcattgtggtcctcagtggcatcctggccactgcgggaacccac
ttcaacactcatgtggacctgaggaccctccgggctgtgcgtgtcctgcggcccttgaag
ctcgtgtcagggatacctagcctgcagattgtgttgaagtccatcatgaaggccatggta
cctcttctgcagattggccttctgctcttctttgccatcctgatgttcgctatcatcggc
ctggagttctacagcgggaagttacaccgagcgtgcttcatgaacaattcaggtattcta
gaaggatttgaccctcctcacccatgcggcgtgcagggctgccccgctggttatgaatgc
aaggattggatcggccccaatgatgggatcacccagtttgataacatcctctttgctgtg
ctaacagtcttccagtgcatcaccatggaagggtggaccaccgtgctgtacaataccaat
gatgccttaggagccacctggaattggctgtacttcatccccctcatcatcattggatcc
ttctttgttctcaacctagtcctgggagtgctttccggggaatttgccaaagagagagag
agagtggagaaccgaagggctttcatgaagctgcggcgccagcagcagattgagcgggag
ctgaatggctaccgggcctggatagacaaagcagaggaagtcatgctcgctgaagaaaat
aaaaatactggaacatccgccttagaagtgcttcgaagggcaaccatcaaaaggagccgg
acagaggccatgacccgagactccagtgatgagcactgtgttgatatctcctctgtgggc
acacccctggctcgagccagtatcaaaagtgcaaaggtagacggggtctcttatttccgg
cacaaggaaaggctcctgcgcatctccattcgccacatggttaaatcccaggtgttttac
tggattgtgctgagccttgtggccctcaacactgcctgtgtggccatcgtccatcacaac
cagccccagtggctcacccacctcctctactatgcagaatttctgtttctgggactcttc
cttttggagatgtccctgaagatgtatggcatgggacctcgcctttattttcactcttca
ttcaactgctttgattttggggtcacagttggcagtatctttgaagtggtctgggcaatc
ttcagacctggtacatcttttggaatcagtgtcttgcgagccctccggcttctaagaata
tttaaaataaccaagtattgggcttccctacggaatttggtggtctccttgatgagctcg
atgaagtctatcatcagtttacttttcctcctcttcctcttcatcgttgtctttgctctc
ctgggaatgcagttatttggaggcaggtttaactttaatgatgggactccttcagcaaac
tttgacaccttccctgcagccatcatgaccgtgttccagatcctgaccggtgaggactgg
aatgaggtgatgtacaatgggatccgctcccagggcggggtcagctcaggcatgtggtct
gccatttacttcattgtgctcaccttgtttggcaactacacgctactgaatgtgttcttg
gctatcgctgtggataatctggccaatgcccaggagctgaccaaggatgaacaggaggaa
gaagaggccttcaaccagaaacatgcactgcagaaggccaaggaggtcagcccgatgtct
gcacccaacatgccttcgatcgaaagagacagaaggagaagacaccacatgtcgatgtgg
gagccacgcagcagccacctgagggagcggaggcgccggcaccacatgtcggtgtgggag
cagcgcaccagccagctgaggaagcacatgcagatgtctagccaggaggccctcaacagg
gaggaggcgtcgtccatgaacccgctcaaccccctccacccgctcagccccctcagcgca
ctcaacgcccaccccagcctttatcggagacccagggccatcgagggcctggccctgggc
ctggctctggagaagttcgatgaggagcgcatcagccgtggcgggtccctcaagggggag
ggaggggaccgatccggtgccctggacaaccagaggacccccctgtccctgggccagcgg
gagctgccgtggctggccaggtcctgtcatgggaactgtgacccgactcagcaggaggct
ggggtaggagaggctgtggtgaccttcgaggaccgggccaggcacaggcagagccagcgg
cgcagccggcatcgccgcgtcaggacagaaggcaaggagtcctcttcggcctcccggagc
aggtctgccagccaggaacgcagtctggatgaagccatgcccgctgaaggggagaaggag
cacgagctcaggggcagccatggtgccaaggagccgacaatccaagaggagagagcccag
gatttaaggaggaccaacagtctgatgttgtccaggggctccgggctggcaggagccctt
gatgaggcaaacacccccctagttctgccccatcctgagctggaagtggggaaagatgcg
gtgctgacggagcaggagcccgaaggcagcagtgagcaggccctgctgggggatgtgcag
ctagacatgggccgcgtcatcagccacagcgagccggacctctcctgcatcacggccaac
acggacaaggccaccaccgagagcaccagtgtcaccgtcgccatccctgacgtgggcccc
ttggtggactcaaccgtggtgcacattagcaacaagacggatggggaagccagtcccttg
aaggaggcagagatcagagaggatgaggaggaggtggagaacacgaagcagaagaaggag
aaacgtgagacaggcaaagccatggtgccccacagctcgatgttcatcttcagcaccacc
aacccgatccggagggcctgccactacatcgtgaacctgcgctacttcgagatgtgcatc
ctcctggtgatcgcggccagcagcatcgccctggcggcggaggaccccgtcctgaccaac
tcggagcgcaacaaagtcctgaggtattttgactatgtgttcacgggcgtgttcaccttt
gagatggttataaagatgatagaccaaggcttgatcctgcaggacgggtcctacttccga
gacctgtggaacatactggactttgtggtggtcgttggcgcattggtggcctttgctctg
gcgaacgctttgggaaccaacaaaggacgggacatcaagaccatcaagtctctgcgggtg
ctccgggttctaaggccactgaaaaccatcaagcgcttgcccaagctcaaggccgtcttc
gactgcgtggtgacctccttgaagaatgtcttcaacatcctcattgtctacaagctcttc
atgttcatctttgctgtcattgcggttcagctcttcaagggaaagttcttttattgcacc
gacagttccaaggacacagagaaggagtgcataggcaactatgtagatcacgaaaaaaat
aagatggaggtgaagggccgggaatggaagcgccatgaattccattatgacaacattatc
tgggccctgctgaccctcttcaccgtctccacaggggaaggatggcctcaagttctgcag
cactccgtagatgtgacagaggaagaccgaggcccaagccgcagcaaccgcatggagatg
tcgatcttttatgtggtctactttgtggtcttccctttcttctttgtcaatatctttgtg
gctctcatcatcatcaccttccaggagcaaggggataagatgatggaggagtgcagcctg
gagaagaacgagagagcgtgcatcgacttcgccatcagtgccaaacctctcacccgctac
atgccgcagaacaggcacaccttccagtaccgcgtgtggcacttcgtggtgtctccgtcc
ttcgagtacaccattatggccatgatcgctttgaacaccgtcgtgctgatgatgaagtat
tactctgctccctgtacctacgagttggccctgaagtacctgaatattgccttcaccatg
gtgttttccctggaatgcgtcctgaaggtcatcgcttttggctttttgaactatttccga
gacacctggaatatctttgacttcatcaccgtgattggcagtatcacagaaattatcctg
acagacagcaagctggtgaacaccagtggcttcaatatgagttttctgaagctcttccga
gctgcccgcctcatcaagctcctgcgtcagggctataccatacgcattttgctgtggacc
tttgtgcagtcctttaaggccctcccttacgtctgccttttaattgccatgcttttcttc
atttatgccatcattgggatgcaggtatttggaaacataaaattagatgaggagagtcac
atcaaccggcacaacaacttccggagtttctttgggtccctaatgctgctgttcaggagt
gccacaggtgaggcctggcaggagatcatgctgtcgtgcctcggggagaagggctgtgag
cctgacaccaccgcaccgtcggggcagaatgagaatgagcgctgtggcaccgatctggcc
tacgtgtacttcgtctctttcatcttcttctgctccttcttgatgctcaacctgttcgtg
gccgtcatcatggacaactttgagtacctgactcgggactcctccatcctgggccctcac
cacttggacgagttcgtccgcgtctgggcagaatatgaccgagcagcatgtggccgcatc
cattacactgagatgtatgaaatgctgactctcatgtcacctccgctaggcctcggcaag
agatgtccctccaaggtggcatataagaggctggtcctgatgaacatgccagtagctgag
gacatgacggtccacttcacctccacgcttatggctctgatccggacagctctggacatt
aaaattgccaaaggtggtgcagacaggcagcagctagactcggagctgcaaaaggagacc
ctagccatctggccccacctatcccagaagatgctggatctgcttgtgcccatgcccaaa
gcctctgacctgactgtgggcaaaatctatgcagcaatgatgatcatggactactataag
cagagtaaggtgaagaagcagaggcagcagctggaggaacagaaaaatgcccccatgttc
cagcgcatggagccctcatctctgcctcaggagattattgctaatgccaaagccctgcct
tacctccagcaggaccccgtttcaggcctgagtggccggactggatatccttcgatgagt
ccactctctccccaggagatattccagttggcttgtatggaccctgccgatgatggacag
ttccaggaacagcagtctctggagccagaggttagtgaattaaaaagcgtgcagccctct
aaccaaggcatctaccttccttcggacacccaggagcatgcgggatctgggagggcatct
tctatgccacgtctgactgtggatccccaggtggtgacagaccccagctccatgagacgt
tcgttttccactattcgggataagcgttcaaattcctcgtggttggaggaattctccatg
gagcgaagcagtgaaaatacctacaagtcccgtcgccggagttaccactcctcgctgcgg
ctgtcagcccaccgcctgaactctgattcaggccacaagtctgacactcaccgctcgggg
ggcagggagaggggacgatcaaaagagcgaaagcaccttctctctcctgatgtctcccgc
tgcaattcggaggagcgagggacccaggctgactgggagtccccagagcgccgtccatcc
aggtcacccagtgagggcaggtcacagacgcccaaccgacagggcacaggttccctaagc
gagagctccatcccctctgtctctgacaccagcaccccacggagaagtcggcggcagctc
ccgcccgtcccgccaaagccccggcccctcctttcctacagctccctgattcgacatgcg
ggcagcatctctccgcctgctgatggaagccaggagggctccccgctgacctcccaagcc
ctggagagcaacagcgcttgcctgaccgagtcttccaactccccgcacccccagcagggc
caccacatctccccacaacgctacatctccgagccctacctggcccagcatgaagactcc
cacgcctcagactgtggcgaggaggagacgctcactttcgaagcagctgtggctactagc
ctgggccgttccaacaccatcggctctgccccacccctgcggcacagctggcagatgccc
aacgggcactatcggcggcggaggcgcggggggcctgggccaggcctgatgtgtggggct
gtcaacaacctgctgagtgacacggaagaagatgacaaatgctag

DBGET integrated database retrieval system