KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040909
Entry
101040909         CDS       T04350                                 

Gene name
CCNA1
Definition
(RefSeq) cyclin-A1
  KO
K06627  cyclin-A
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04110  Cell cycle
sbq04152  AMPK signaling pathway
sbq04218  Cellular senescence
sbq04914  Progesterone-mediated oocyte maturation
sbq05161  Hepatitis B
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05203  Viral carcinogenesis
sbq05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101040909 (CCNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101040909 (CCNA1)
   04218 Cellular senescence
    101040909 (CCNA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101040909 (CCNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101040909 (CCNA1)
   05202 Transcriptional misregulation in cancer
    101040909 (CCNA1)
   05203 Viral carcinogenesis
    101040909 (CCNA1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101040909 (CCNA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101040909 (CCNA1)
   05161 Hepatitis B
    101040909 (CCNA1)
   05169 Epstein-Barr virus infection
    101040909 (CCNA1)
   05165 Human papillomavirus infection
    101040909 (CCNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sbq03032]
    101040909 (CCNA1)
   03036 Chromosome and associated proteins [BR:sbq03036]
    101040909 (CCNA1)
DNA replication proteins [BR:sbq03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101040909 (CCNA1)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    101040909 (CCNA1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2
Other DBs
NCBI-GeneID: 101040909
NCBI-ProteinID: XP_010343282
UniProt: A0A2K6T949
LinkDB
Position
Unknown
AA seq 421 aa
MHCNNSKSGVVLATVARGPDACQIPTRAQVGQDAPQRTVLGLLTENGQYRRTCGQGITTI
RCFSGSENAFPPAGKKALPDCKVQEPPKQGFDIYMDELEQGNGDSCSGREGTAFEDVYEV
DTSTLKSDLHFLLDFDTVSPMLVDSSLHSQPEDISDLDTDVINVTEYAEEIHQYLREAEI
RHRPKAHYMRKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRG
KLQLVGTAAILLASKYEEIYPPEVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLMVPTT
NQFLLQYLRRQGVCIRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFW
PETLAAFTGYSLSEIVPCLSELHKAFLGIPHRPQQAIREKYKASKYLHVSLMEPPAVLPL
Q
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcactgcaacaactccaagagtggagttgtgctggctacagtggcccgaggtcccgat
gcttgtcagatacccaccagagcccaggtgggccaggatgccccgcagaggacagtgcta
gggctgctgactgaaaatgggcagtacaggaggacctgtggccaggggatcacaacaatc
aggtgtttttctggatcagaaaatgccttccctccagctggaaagaaagcactccctgat
tgcaaggtccaagagccccccaagcaagggtttgacatctacatggatgaactagagcag
ggcaatggagacagctgctcaggcagagaggggacggcatttgaggatgtgtatgaagta
gataccagcacactcaagtcagacctgcacttcctgctggatttcgacacagtttcccct
atgctggtagattcatcgctccactcccagcctgaagatatatctgatcttgacaccgat
gtgataaatgtgactgaatacgctgaagaaattcatcaataccttagagaagctgaaata
aggcacagacccaaagcacactacatgaggaagcaaccggacatcacagagggcatgcgc
accattctggtggactggctggtggaggttggggaagaatataagcttcgagcagagact
ctgtacctggctgtcaacttcctggacagattcctttcgtgtatgtctgttctgagaggg
aaattgcagctcgtaggaacagcagctattcttttggcttcgaaatatgaagagatatat
cctcccgaggtagacgagtttgtctatataactgatgatacatacacaaaacggcaactg
ttaagaatggaacacttgcttctgaaagttctagcttttgatctgatggtaccaaccacc
aaccagtttctccttcagtacttgaggcgacaaggagtgtgcatcaggacagagaacctg
gctaagtatgtagcagagctgagtctacttgaagcagacccattcttgaaatatcttcct
tcattgatagctgcagcagctttttgcctggcaaactataccgtgaacaagcacttttgg
ccagaaactcttgcagcatttacagggtattcattaagtgaaattgtgccttgtctgagt
gagcttcataaagcgttccttggcataccccatcgacctcagcaagcaattagggagaag
tataaggcttcaaagtacctgcatgtgtctctcatggaaccacctgcagttcttcctctg
cagtaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 104652690
Entry
104652690         CDS       T04350                                 

Gene name
CCNA2
Definition
(RefSeq) cyclin-A2
  KO
K06627  cyclin-A
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04110  Cell cycle
sbq04152  AMPK signaling pathway
sbq04218  Cellular senescence
sbq04914  Progesterone-mediated oocyte maturation
sbq05161  Hepatitis B
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05203  Viral carcinogenesis
sbq05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    104652690 (CCNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104652690 (CCNA2)
   04218 Cellular senescence
    104652690 (CCNA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    104652690 (CCNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104652690 (CCNA2)
   05202 Transcriptional misregulation in cancer
    104652690 (CCNA2)
   05203 Viral carcinogenesis
    104652690 (CCNA2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    104652690 (CCNA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104652690 (CCNA2)
   05161 Hepatitis B
    104652690 (CCNA2)
   05169 Epstein-Barr virus infection
    104652690 (CCNA2)
   05165 Human papillomavirus infection
    104652690 (CCNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sbq03032]
    104652690 (CCNA2)
   03036 Chromosome and associated proteins [BR:sbq03036]
    104652690 (CCNA2)
DNA replication proteins [BR:sbq03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    104652690 (CCNA2)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    104652690 (CCNA2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_N2 Cyclin_C
Other DBs
NCBI-GeneID: 104652690
NCBI-ProteinID: XP_010345023
UniProt: A0A2K6UKY6
LinkDB
Position
Unknown
AA seq 432 aa
MLGNSAPEPAAREAGSALLALQQTALQEDQENINPEKAAPIQPPRTRAALAVLKAGNPRG
ASQQQRPKTRRVAPLKDLPVNDENVTVPSWKANSKQPAFTIHVDEAEEETLKKPAECQKA
ECEDVMAFNSAVSLPGPRKPLVPLDYPMDGSFESPHTMDMSIVLEDEKPVSVNEVPDYHE
DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYID
RFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
VLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAF
HLALYTVTGQSWPESLVQKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKHSKYHG
VSLLNPPDTLNL
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgttgggcaactccgcgccggagcctgcagcccgcgaggcgggctcggcgctgctagca
ttgcagcagactgcgctccaagaggaccaggagaacatcaacccggaaaaggcagcgcct
atccagccaccgcggacccgggccgcgctggcggtactgaaggccgggaacccgcggggt
gcatcgcagcagcagaggccgaagacgcgacgggttgcacctcttaaggatcttcctgta
aatgatgagaatgtcaccgttccttcttggaaagcaaacagtaaacagcctgcattcacc
attcatgtggatgaagcagaagaggagactcttaagaagccagctgaatgccagaaagca
gagtgtgaagatgtcatggcttttaattcagccgttagtttacctggacccagaaaacca
ttggtacctcttgattatccaatggatggtagttttgagtcaccacatactatggacatg
tcaattgtattagaagatgaaaagccagtgagtgttaatgaagtaccagactaccatgag
gatattcacacataccttagggaaatggaggttaaatgtaaacctaaagtgggttacatg
aagaaacagccagacatcactaacagtatgagagctatcctcgtggactggttagttgaa
gtaggagaagaatataaactacagaatgagaccctgcatttggctgtgaactacattgat
aggttcctttcttccatgtccgtgctgagaggaaagcttcagcttgtgggcactgctgct
atgctgttagcctcaaagtttgaagaaatataccccccagaagtagcagagtttgtgtac
attacagatgatacctacaccaagaaacaagttctgagaatggagcatctagttttgaaa
gtccttacttttgacttagctgctccaacagtaaatcagtttcttacccaatactttctg
catcagcagcctgcaaactgcaaagttgaaagtttagcaatgtttttgggagaattaagt
ttgatagatgctgacccatatctgaagtatttgccatcagttattgctggagctgccttt
catttagcactctatacagtcacgggacaaagctggcctgaatcattagtacagaagact
ggatataccctggaaagtcttaagccttgtctcatggaccttcatcagacctacctcaaa
gcaccacagcatgcacaacagtcaataagagaaaagtacaaacattcaaagtatcatggt
gtttctctcctcaacccaccagacacactaaatctgtaa

DBGET integrated database retrieval system