KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040924
Entry
101040924         CDS       T04350                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04390  Hippo signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq05200  Pathways in cancer
sbq05218  Melanoma
sbq05224  Breast cancer
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101040924 (FGF1)
   04014 Ras signaling pathway
    101040924 (FGF1)
   04015 Rap1 signaling pathway
    101040924 (FGF1)
   04390 Hippo signaling pathway
    101040924 (FGF1)
   04151 PI3K-Akt signaling pathway
    101040924 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101040924 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101040924 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    101040924 (FGF1)
   05218 Melanoma
    101040924 (FGF1)
   05224 Breast cancer
    101040924 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101040924 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101040924 (FGF1)
Cytokines and growth factors [BR:sbq04052]
 Growth factors
  Growth factors (RTK binding)
   101040924 (FGF1)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   101040924 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 101040924
NCBI-ProteinID: XP_003920596
UniProt: A0A2K6SYQ2
LinkDB
Position
Unknown
AA seq 155 aa
MAEGEITTFTALTEKFDLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDLHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcaccacctttacagccctgaccgagaagtttgatctgcctcca
gggaattacaagaagcccaaactcctctactgtagcaacgggggccacttcttgaggatc
cttccggatggcacagtggatgggaccagggacaggagcgatcttcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgacgggcttttatacggctcacagacaccaaatgaggaatgtttgttc
ctggaaaggctggaggagaaccattacaacacctatatatccaagaaacacgcagagaag
aattggtttgttggcctcaagaagaatggaagctgcaagcgcggtcctcggactcactat
ggccagaaagcaatcttgtttctccccctgccagtctcttctgattaa

DBGET integrated database retrieval system