KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040943Help
Entry
101040943         CDS       T04350                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00480  Glutathione metabolism
sbq00980  Metabolism of xenobiotics by cytochrome P450
sbq00982  Drug metabolism - cytochrome P450
sbq00983  Drug metabolism - other enzymes
sbq01524  Platinum drug resistance
sbq05200  Pathways in cancer
sbq05204  Chemical carcinogenesis
sbq05225  Hepatocellular carcinoma
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101040943 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101040943 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    101040943 (GSTO1)
   00983 Drug metabolism - other enzymes
    101040943 (GSTO1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    101040943 (GSTO1)
   05204 Chemical carcinogenesis
    101040943 (GSTO1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    101040943 (GSTO1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101040943 (GSTO1)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    101040943 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbq02000]
    101040943 (GSTO1)
Enzymes [BR:sbq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101040943 (GSTO1)
Transporters [BR:sbq02000]
 Other Transporters
  Pores ion channels [TC:1]
   101040943 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 101040943
NCBI-ProteinID: XP_003922270
UniProt: A0A2K6SKK7
LinkDB All DBs
Position
Unknown
AA seq 241 aa AA seqDB search
MSGESARSLGKGSAPPGPVPQGLIRVYSMRFCPFAERTRLVLKAKGIRHEVININLKNKP
EWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLFPDDPYEKACQKMVFELF
SKVPSLVGSFIRSQNKEDCAGLKEEFRKEFSKLEEVLTNKKTTFFGGSSISMIDYLIWPW
FERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSVKDWQGFLELYLQNSPEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccggggagtcagccaggagcctggggaagggaagcgcgcccccagggccggtccca
cagggcctgatccgcgtctacagcatgaggttctgcccgtttgctgagaggacgcgtctg
gttctgaaggccaagggaatcaggcatgaagtcatcaatatcaacctgaaaaataagcct
gagtggttctttaagaaaaatccctttggtctggtgccagttttggaaaacagtcaggga
cagctgatctatgagtctgccatcacttgtgagtacctggatgaagcatacccagggaag
aagctgtttcctgatgacccctatgagaaagcctgccagaagatggtctttgagttgttt
tctaaggtgccatccttggtaggaagctttattagaagccaaaataaggaagactgtgct
ggcctaaaagaagaatttcgtaaagaatttagcaagctagaggaggttctgactaataag
aagacaaccttctttggtggcagttctatctcgatgattgattacctcatctggccctgg
tttgaacggctggaagcaatgaagttaaatgagtgtgtagatcacactccaaaacttaaa
ctgtggatggcagccatgaaggaagatcccacagtctcagccctgctcactagtgtgaag
gactggcaaggtttcctagagctgtacttacagaacagccctgaggcctgtgactatggg
ctctga

DBGET integrated database retrieval system