KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040990Help
Entry
101040990         CDS       T04350                                 

Gene name
HDAC8
Definition
(RefSeq) histone deacetylase 8 isoform X1
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq05034  Alcoholism
sbq05165  Human papillomavirus infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    101040990 (HDAC8)
  09164 Substance dependence
   05034 Alcoholism
    101040990 (HDAC8)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    101040990 (HDAC8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sbq03036]
    101040990 (HDAC8)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101040990 (HDAC8)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     101040990 (HDAC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl DNase-RNase
Motif
Other DBs
NCBI-GeneID: 101040990
NCBI-ProteinID: XP_010330690
LinkDB All DBs
Position
Unknown
AA seq 383 aa AA seqDB search
MEEPEEPEDSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRVVKPK
VASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAVGGATI
TAAQCLIDGMSKVAINWSGGWHHAKNNLFSYRDEASGFCYLNDAVLGILRLRRKFERILY
VDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDG
IQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYVLQW
QLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRP
DRNEPHRIQQILNYIKGNLKHVV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaagagccggaggaaccggaggatagtgggcagtcgctggtcccggtttatatctat
agtcccgagtatgtcagtatgtgtgactccctggccaagatccccaaacgggccagtatg
gtacattctttgattgaagcatacgcactgcataagcaaatgagggtagttaagcccaaa
gtggcctccatggaggagatggccaccttccacactgatgcttatctgcagcatctccag
aaggtcagccaagagggcgatgatgatcatccggactccatagaatatgggctaggttat
gactgcccagccactgaagggatatttgactatgcagcagctgtaggaggagctacgatc
acagctgcccagtgcctgattgatggaatgtccaaagtagcaattaactggtctggaggg
tggcatcatgcaaagaacaacttgttttcttacagagatgaagcatctggtttttgttat
ctcaatgatgctgtcctgggaatattacgattgcgacggaaatttgagcgtattctctac
gtggatttggatctgcaccatggagatggtgtagaagacgccttcagtttcacctccaaa
gtcatgactgtgtccttgcacaaattctccccgggatttttcccaggaacaggtgatgtg
tctgatgttggcctggggaagggacggtactacagtgtaaatgtgcccattcaggatggc
atacaagatgaaaaatattaccagatctgtgaaagtgtactaaaggaagtataccaagcc
tttaatcccaaagcagtggtcttacagctgggagctgacacaatagctggggatcccatg
tgctcctttaacatgactccagtgggaattggcaagtgtcttaagtacgtccttcaatgg
caattggcaacactcattttgggaggaggaggctataaccttgccaacacggctcgatgc
tggacatacttgaccggggtcatcctagggaaaacactatcctctgagatcccagatcat
gagtttttcacagcatatggtcctgattatgtgctggaaatcacaccaagctgccggcca
gaccgcaatgagccccaccgaatccagcaaatcctcaactacatcaaagggaatctgaag
catgtggtctaa

DBGET integrated database retrieval system