KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040995
Entry
101040995         CDS       T04350                                 

Gene name
GAB1
Definition
(RefSeq) GRB2-associated-binding protein 1 isoform X4
  KO
K09593  GRB2-associated-binding protein 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04722  Neurotrophin signaling pathway
sbq05100  Bacterial invasion of epithelial cells
sbq05205  Proteoglycans in cancer
sbq05211  Renal cell carcinoma
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101040995 (GAB1)
   04014 Ras signaling pathway
    101040995 (GAB1)
   04072 Phospholipase D signaling pathway
    101040995 (GAB1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101040995 (GAB1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101040995 (GAB1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101040995 (GAB1)
   05226 Gastric cancer
    101040995 (GAB1)
   05211 Renal cell carcinoma
    101040995 (GAB1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101040995 (GAB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101040995 (GAB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sbq04990]
    101040995 (GAB1)
Domain-containing proteins not elsewhere classified [BR:sbq04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   101040995 (GAB1)
SSDB
Motif
Pfam: PH PH_11 PH_9 PH_8 PH_3 PH_13
Other DBs
NCBI-GeneID: 101040995
NCBI-ProteinID: XP_003928066
LinkDB
Position
Unknown
AA seq 694 aa
MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRII
DLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPT
EEEPVKPPGSSLQAPADLPLAINTAPPSTQADSSSATLPPPYQLINVPPHLETLGIQEDP
QDYLLLINCQSKKPEPTRTHTDSAKSTSSETDCNDNVPSHKTPASSQSKHGMNGFFQQQM
IYDSPPSRATSASVDSSLYNLPRSYSHDVLPKVSPSSTEADGELYVFNTPSGTSSLETQM
RHVSISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPPKPHPAHDRSPVETC
SIPRTASDTDSSYCIPTAGMPPSRSNTISTVDLNKLRKDASSQDCYDIPRTFPSDRSSSL
EGFHNHFKVKNVLTVGSVSSEELDENYVPMNPNSPPRQHSSSFTEPIQEANYVPMTPGTF
DFSSFGMQVPPPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKVKPAPLEIKPLP
EWEELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSED
PNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKTSGSGSSVADERVDYV
VVDQQKTLALKSTREAWTDGRQSTESETPTKSVK
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgagcggcggcgaagtggtctgctccggatggctccgaaagtctcccccggagaaaaag
ttgaagcgttatgcatggaagcggagatggttcgtgttacgcagtggccgtttaactgga
gatccagatgttttggaatattacaaaaatgatcatgccaagaagcctattcgtatcatt
gatttaaatttgtgtcaacaagtagatgctggattgacatttaacaaaaaagagtttgaa
aacagctacatttttgatatcaacactattgaccggattttctacttggtagcagacagc
gaggaggagatgaataagtgggttcgttgtatttgtgacatctgtgggtttaatcctaca
gaagaggagcctgtgaagccacctggcagctccttacaagcaccagctgatttaccttta
gctataaatacagcaccaccatccacccaggcggattcatcttctgctactctacctcct
ccgtatcagctaatcaacgttccgccacacctggaaactcttggcattcaggaggatcct
caagactacctgttgctcatcaactgtcaaagcaagaagcccgaacccaccagaacacac
actgattctgcgaaatccacctcttctgaaacagactgcaatgataacgtcccttctcat
aaaactcctgcttcctcccagagcaaacatggaatgaatggcttctttcagcagcaaatg
atatacgactctccaccttcacgtgccacatctgcttctgtagactccagcctttataac
ctgcccaggagttattcccatgatgttttaccaaaggtgtctccgtcaagtactgaagca
gatggagaactctatgtttttaatactccctctgggacatcgagtttagagactcaaatg
aggcatgtatctattagttatgacattcctccaacacctggtaatacttatcagattcca
cgaacatttccagaaggaaccttgggacagacatcaaagctagacactattccagatatt
cctccaccccggccaccgaaaccacatccagctcatgaccgatctcctgtggaaacgtgt
agcatcccacgtacggcctcagacactgacagtagttactgtatccctactgcagggatg
ccgccatcacgtagtaataccatttccactgtggatttaaacaaattgcgaaaagatgct
agttctcaagactgctatgatattccacgaacatttccaagtgatagatctagttcactt
gaaggcttccataaccacttcaaagtcaaaaatgtgctgacagtgggaagtgtttcaagt
gaagaattggatgaaaattacgtcccaatgaatcccaactcaccaccacgacaacattcc
agcagttttacagaaccaattcaggaagcaaattatgtgccaatgactccgggaacattt
gatttttcctcatttggaatgcaagttcctcctcctgctcatatgggctttaggtcgagc
ccaaaaactcctcccagaaggccagttcctgttgcagactgtgaaccacccccggtggat
aggaacctcaagccagacagaaaagtcaagccagcacctttagaaataaaacctttgcca
gaatgggaagaattacaagccccagttagatctcccatcactaggagttttgctcgagac
tcttctaggtttcccatgtctccccgaccggattcagtgcacagcacaacttcaagcagc
gactcacatgacagtgaagagaattatgttcccatgaacccaaacctgtccagtgaagac
ccaaatctctttggcagtaacagtcttgatggaggaagcagccctatgatcaagcctaaa
ggagacaaacaggtggaatacctagatctcgacttagattctgggaaatccacaccacca
cgcaagcaaaagaccagtggctcaggcagcagtgtagcagatgagagggtggattatgtc
gttgttgaccaacagaagaccttggctctcaagagtacccgggaagcctggacagatggg
agacagtccacagaatcagaaacgccaacaaagagtgtgaaatga

DBGET integrated database retrieval system