KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101041016
Entry
101041016         CDS       T04350                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00220  Arginine biosynthesis
sbq00330  Arginine and proline metabolism
sbq01100  Metabolic pathways
sbq04020  Calcium signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04146  Peroxisome
sbq04371  Apelin signaling pathway
sbq04926  Relaxin signaling pathway
sbq05010  Alzheimer disease
sbq05014  Amyotrophic lateral sclerosis
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05133  Pertussis
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05146  Amoebiasis
sbq05152  Tuberculosis
sbq05200  Pathways in cancer
sbq05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    101041016 (NOS2)
   00330 Arginine and proline metabolism
    101041016 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101041016 (NOS2)
   04066 HIF-1 signaling pathway
    101041016 (NOS2)
   04020 Calcium signaling pathway
    101041016 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101041016 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101041016 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101041016 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101041016 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101041016 (NOS2)
   05014 Amyotrophic lateral sclerosis
    101041016 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101041016 (NOS2)
   05152 Tuberculosis
    101041016 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101041016 (NOS2)
   05145 Toxoplasmosis
    101041016 (NOS2)
   05140 Leishmaniasis
    101041016 (NOS2)
   05142 Chagas disease
    101041016 (NOS2)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     101041016 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 101041016
NCBI-ProteinID: XP_010340331
UniProt: A0A2K6U7L6
LinkDB
Position
Unknown
AA seq 1152 aa
MACPWRFLFKATFRQDVTTEGKDINNNVGKAPCATSSPVAQDDPLRHSLGKPQKESSQPL
VETGKKSPQSLVKLDATPSSCPRHVRIKNWGNGMTFQDTLHHKAKGILTCRSKSCLGSIM
TPKSLTRGPRDKPTHPDELLPQAIEFVNQYYSSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHLRYSTNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELKLKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGSRMGLETHKLASLWKDQAVVEINI
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRARGGCPADWIWLVPPISGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHDWQDKKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT
ILFATETGKSEALAWDLGALFSCAFNPQVLCMDKYRLSCLEEERLLLVVTSTFGNGDCPG
NGEKLKKSLFTLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLTPTGEGD
ELSGQEDAFRSWAVQTFKAACEAFDVRGKQHIQIPKLYTSSVTWDPHHYRLVQDSQPLDL
SKALSSMHAKNVFTMRLKSRQNLQSLKSSRATILVELSCEDGQSLNYLPGEHLGVCPGNQ
PALVQGILERVVDGPAPHQTVHLEALDESGSYWVRDKRLPPCSLSQALTYFLDITTPPSQ
LLLQKLAQVATETAERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRFYSISSSRDHTPTEIHLTVAVVMYHTQDGQGPLHHGVCSTWLNSLKPQDPVPCF
VRNAGGFQLPEDPSHPCILVGPGTGIAPFRSFWQQRLHDSQHKGVQGGRMTLVFGCRRPD
EDHIYLEEMLEMARKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHEEPGHLY
VCGDVRMARDVARTLKQLVAAKLNLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKDRA
AVQPSSLEMSAL
NT seq 3459 nt   +upstreamnt  +downstreamnt
atggcctgtccttggaggtttctgttcaaagccacattccgccaggatgtaacgacggag
ggaaaagacatcaacaacaatgtgggcaaagccccctgtgccacctccagtccggtggca
caggatgaccccctgcgtcacagcctcggcaagccccagaaggagtcctcacagcccttg
gtggagacaggaaagaagtctccacaatccctggtcaagctggatgcaaccccatcgtcc
tgcccacggcacgtgaggatcaaaaactggggtaacgggatgactttccaagacacactt
caccacaaggccaaagggattttgacttgcaggtctaaatcttgcctggggtctattatg
actcccaaaagtttgaccagaggacccagggacaagcctacccatccagacgagcttcta
cctcaagctatcgaatttgtcaaccaatattacagctccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagcagtaacaaaggagatagaaacaacaggaacctaccaa
ctgacgggagatgagctcatcttcgccaccaagcaggcctggcgcaatgccccgcgctgc
atcgggaggatccagtggtccaacctgcaggtcttcgacgcccgcagctgttccaccgcc
cgggagatgtttgaacacatctgtagacacctgcgttactccaccaacaatggcaacatc
aggtcggccatcaccgtgttcccccagcggagcgatggcaagcacgacttccgggtgtgg
aacgctcagctcatccgctatgcgggctaccagatgcccgatggcagcatcagaggggac
cctgccaacgtggaattcactcagctgtgcatcgacctgggctggaagcccaagtacggc
cgcttcgatgtagtgcccctggtcctgcaggccaacggccgtgaccctgagctctttgaa
atcccacctgaccttgtgcttgaggtggccatggaacatcccaagtacgagtggtttcgg
gagctgaagctaaagtggtatgccctgcctgcagtggccaacatgctactcgaggtgggc
ggcctggagttcccggggtgccccttcaatggctggtacatgggcacagagatcggagtc
cgggacttctgtgacgtccagcgctacaacatcctggaggaagtgggcagcagaatgggc
ttggaaacgcacaagctggcttcgctctggaaagaccaggctgtcgttgagatcaacatt
gctgtgctccatagtttccagaagcagaatgtgaccatcatggaccaccactcggctgca
gaatccttcatgaagtacatgcagaacgaataccgggcccgcgggggctgcccggccgac
tggatttggctggtccctcccatatccgggagtatcacccccgtgtttcaccaggagatg
ctgaactacgtcctgtcccctttctactattatcaggtagaggcctggaaaacccatgac
tggcaggacaagaagcggagacccaagagaagagagattccgttgaaagtcttggtcaaa
gccgtgctctttgcctgtatgctgatgcgcaagacgatggcgtcccgagtcagagtcacc
atcctttttgcgacagagacgggaaaatcagaggcgttggcctgggacctgggagccttg
ttcagctgtgccttcaacccccaggttctctgcatggacaagtacaggctgagctgcctg
gaggaggagcggctgctgctggtggtgaccagcacgttcgggaacggagactgccccggc
aacggagagaaactaaagaaatccctcttcacactgaaagagctcaccaacaaattcagg
tacgcggtgtttggcctcggctccagcatgtaccctcagttctgcgcgtttgctcatgac
attgaccagaagctgtcccacctgggggcctctcagctcaccccgacgggagaaggggat
gagctcagtgggcaggaagatgccttccgcagctgggctgtgcaaaccttcaaggccgcc
tgtgaggcgtttgatgtccgaggcaaacagcacattcagatccccaagctctacacctcc
agtgtgacctgggacccgcaccactacaggctcgtgcaggactcacagcctttggacctc
agcaaagccctcagcagcatgcacgccaagaacgtgttcaccatgaggctgaaatctcgg
cagaatctacagagtctgaaatccagccgcgccaccatcctggtggaactctcctgtgag
gacggccagagcctgaactacctgccaggggagcaccttggggtttgcccaggcaaccag
ccagccctggttcaaggcatcctggagcgagtggtggacggccccgcgccccaccagaca
gtgcacctggaggccctggacgagagtggcagctactgggtcagagacaagaggctgccc
ccctgctcactcagccaggccctcacctacttcctggacatcaccacccccccatcccag
ctgctgctccaaaagctggcccaggtggccacagaaacagctgagagacagagactggag
gccctgtgccagccctcagagtacagcaagtggaagttcaccaacagccccacgttcctg
gaggtgctggaggagttcccatccctgcgggtgtctgctggcttcctgctctcccagctc
cccattctgaagccccggttctactccatcagctcctcccgggatcacacacccaccgag
atccacctgactgtggccgtggtcatgtaccacacccaagatggccagggtcccctgcac
cacggcgtctgcagcacgtggctcaacagcctgaagccccaagacccagtgccctgcttt
gtgcgaaatgccggcggcttccagctccccgaggacccctcccatccttgcatcctggtc
gggcctggcacaggcatcgccccgttccgcagtttctggcagcagcggctccacgactcc
cagcacaagggagtgcagggagggcgcatgaccctggtgttcgggtgccgccgcccagat
gaggaccacatctacctggaggagatgctggagatggcccggaagggggtgctgcacgcg
gtgcacacagcctattcccgcctgccgggcaagcccaaggtctatgttcaggacatcctg
cggcagcagctggccagcgaggtgctccgtgtgctccacgaggagccgggtcacctctat
gtttgtggggacgtgcgcatggcccgggatgtggctcgcaccctgaagcagttggtggct
gccaagctgaacttgaatgaggagcaggtcgaggactatttctttcagctcaagagtcag
aagcgctatcatgaagatatctttggtgctgtatttccctacgaggcgaaggacagggcg
gcggtgcagcccagcagcctggagatgtccgcgctctga

DBGET integrated database retrieval system