KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101041291
Entry
101041291         CDS       T04350                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01524  Platinum drug resistance
sbq04141  Protein processing in endoplasmic reticulum
sbq04210  Apoptosis
sbq04215  Apoptosis - multiple species
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05160  Hepatitis C
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05203  Viral carcinogenesis
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05216  Thyroid cancer
sbq05217  Basal cell carcinoma
sbq05218  Melanoma
sbq05220  Chronic myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101041291 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101041291 (BAK1)
   04215 Apoptosis - multiple species
    101041291 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101041291 (BAK1)
   05202 Transcriptional misregulation in cancer
    101041291 (BAK1)
   05206 MicroRNAs in cancer
    101041291 (BAK1)
   05203 Viral carcinogenesis
    101041291 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101041291 (BAK1)
   05212 Pancreatic cancer
    101041291 (BAK1)
   05225 Hepatocellular carcinoma
    101041291 (BAK1)
   05226 Gastric cancer
    101041291 (BAK1)
   05214 Glioma
    101041291 (BAK1)
   05216 Thyroid cancer
    101041291 (BAK1)
   05220 Chronic myeloid leukemia
    101041291 (BAK1)
   05217 Basal cell carcinoma
    101041291 (BAK1)
   05218 Melanoma
    101041291 (BAK1)
   05213 Endometrial cancer
    101041291 (BAK1)
   05224 Breast cancer
    101041291 (BAK1)
   05222 Small cell lung cancer
    101041291 (BAK1)
   05223 Non-small cell lung cancer
    101041291 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    101041291 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101041291 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101041291 (BAK1)
   05160 Hepatitis C
    101041291 (BAK1)
   05164 Influenza A
    101041291 (BAK1)
   05162 Measles
    101041291 (BAK1)
   05168 Herpes simplex virus 1 infection
    101041291 (BAK1)
   05163 Human cytomegalovirus infection
    101041291 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101041291 (BAK1)
   05169 Epstein-Barr virus infection
    101041291 (BAK1)
   05165 Human papillomavirus infection
    101041291 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101041291 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sbq03029]
    101041291 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbq02000]
    101041291 (BAK1)
Mitochondrial biogenesis [BR:sbq03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    101041291 (BAK1)
Transporters [BR:sbq02000]
 Other transporters
  Pores ion channels [TC:1]
   101041291 (BAK1)
SSDB
Other DBs
NCBI-GeneID: 101041291
NCBI-ProteinID: XP_010332496
LinkDB
Position
Unknown
AA seq 122 aa
MASGQGPGPPRQECGEPDPPSASEEQVARDTEEVFHSYVFYRHRQEQEAEGAAAPADPEM
VSLSLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLLPTDSLQVKALTPIPGDPGT
VT
NT seq 369 nt   +upstreamnt  +downstreamnt
atggcttcggggcaaggcccaggtcctcccaggcaggagtgcggagagcctgacccaccc
tctgcttctgaggagcaggtagcccgggacacggaggaagttttccacagctacgttttt
taccgccatcggcaggaacaggaggctgaaggggcggctgcccctgctgacccagagatg
gttagcttgtctctccaacctagcagcaccatggggcaggtgggacggcagctcgccatc
attggggatgacatcaaccggcgctatgactcggagttccagaccatgctgcaacacttg
ctcccaaccgattcactacaggtgaaggccctcacccccatccctggggaccctggaacg
gtcacatga

DBGET integrated database retrieval system