KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101041327Help
Entry
101041327         CDS       T04350                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease serine 2 isoform X2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq05164  Influenza A
sbq05202  Transcriptional misregulation in cancer
sbq05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    101041327 (TMPRSS2)
  09162 Cancers: Specific types
   05215 Prostate cancer
    101041327 (TMPRSS2)
  09172 Infectious diseases: Viral
   05164 Influenza A
    101041327 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sbq01002]
    101041327 (TMPRSS2)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101041327 (TMPRSS2)
Peptidases [BR:sbq01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101041327 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Trypsin_2 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 101041327
NCBI-ProteinID: XP_003927643
UniProt: A0A2K6SG00
LinkDB All DBs
Position
Unknown
AA seq 491 aa AA seqDB search
MALNSGSPPGVGPYYENHGYQPENPYPAQPTAAPNVYMVYPAQHYPSPLPQYAPRVPTHA
SNPVSTQPRSPSGRVCTSKTKKALCITLALGTVLAGAALAAGLVWKFMEGKCSVSGMECG
SSGICVSPSNWCDGVSHCPSGEDENRCVRLYGPTFILQVYSSQRRSWHPVCHDDWNENYG
RAACRDMGYKNSFYSSQGIVDDSGTTSFMKLNMSAGNVDIYKKLYHSDACSSKAVVSLRC
IACGVTSNSSRQSRIVGGVRAPEGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKP
LNNPRHWTAFAGILSQSLMFYGSGHRVEKVISHPSYDSQTKNNDIALMKLQTPLTFSDAV
KPVCLPNPGMNLDPEQPCWISGWGATEEKGKTSDVLKAAMVPLIDPQRCNSRYVYNNLIT
PAMICAGFLKGTVDSCQGDSGGPLVTLKNSVWWLIGDTSWGSGCAKAYRPGVYGNVTVFT
DWIYQQMRADG
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggctttgaactcagggtcaccgccaggcgttggaccttactatgaaaaccacggatac
caaccggaaaacccctatcccgcacagcccactgcggctcccaatgtctacatggtgtat
ccagctcagcactacccgtccccgctaccccagtacgccccgagggtcccaacgcacgct
tctaaccccgtcagcacgcagcccagatccccatcggggagagtgtgcacctcaaagact
aagaaagcactgtgtatcaccttggccctggggaccgtcctcgcaggagctgcgctggcc
gctggcctggtctggaagttcatggagggcaagtgttccgtctctgggatggagtgcggc
tcctcgggcatctgcgtcagcccctccaactggtgcgacggcgtgtcacactgtcccagt
ggggaggacgagaaccggtgtgttcgcctctatggaccgaccttcatccttcaggtgtac
tcatctcagaggaggtcctggcaccctgtgtgccacgacgactggaatgagaactacggg
cgggcggcctgcagggacatgggctacaagaatagtttttactctagccaaggaatagtg
gatgacagcgggaccacaagctttatgaaactgaacatgagtgccggcaatgttgatatc
tacaaaaaactctaccacagtgatgcctgttcttcaaaagcagtagtttctctgcgctgt
atagcctgcggggtcacctcgaactcaagccgccagagcaggatcgtgggtggtgtgaga
gcacctgagggggcgtggccctggcaggtcagcctgcacgtccagaacgtccacgtgtgt
ggaggctccatcatcacccccgagtggattgtgacggctgcccactgcgtggaaaaacct
cttaacaatccgcggcattggacggcatttgcggggattttgagccaatctctcatgttc
tatggaagtggacaccgggtagaaaaagtgatttctcatccaagttacgactcccagacc
aagaacaatgacattgcgctgatgaagctgcagacgcctctgactttcagcgacgcagta
aaaccagtgtgtctgcccaacccaggcatgaatctggatccggagcagccctgctggatt
tctgggtggggggccactgaggagaaagggaagacctcagatgtgctgaaggctgccatg
gtgcctctcattgacccgcagagatgcaacagcagatacgtctacaacaacctgatcacg
ccggccatgatctgtgccggcttcctgaaggggaccgtcgattcctgccagggtgacagt
ggagggcctctggtcactttgaagaacagtgtctggtggctgatcggggataccagctgg
ggatccggctgtgctaaggcttacagaccaggagtgtacgggaacgtgacggtgttcacg
gactggatttaccagcaaatgagggcagacggctaa

DBGET integrated database retrieval system