KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101041803
Entry
101041803         CDS       T04350                                 

Gene name
DDX3X
Definition
(RefSeq) ATP-dependent RNA helicase DDX3X isoform X1
  KO
K11594  ATP-dependent RNA helicase DDX3X [EC:3.6.4.13]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq05161  Hepatitis B
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    101041803 (DDX3X)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101041803 (DDX3X)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101041803 (DDX3X)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sbq03019]
    101041803 (DDX3X)
   03041 Spliceosome [BR:sbq03041]
    101041803 (DDX3X)
   03036 Chromosome and associated proteins [BR:sbq03036]
    101041803 (DDX3X)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     101041803 (DDX3X)
Messenger RNA biogenesis [BR:sbq03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     101041803 (DDX3X)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     101041803 (DDX3X)
Spliceosome [BR:sbq03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    101041803 (DDX3X)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    101041803 (DDX3X)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII UTP25
Other DBs
NCBI-GeneID: 101041803
NCBI-ProteinID: XP_003924079
LinkDB
Position
Unknown
AA seq 661 aa
MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGW
SSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRDRSGFGKFER
GGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIES
FSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQ
IYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVY
GGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQI
RRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVW
VEEADKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDRE
EALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLA
TSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARD
YRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWG
N
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgagtcatgtggcggtggaaaatgcgctcgggctggaccagcagtttgctggcctagac
ctgaactcttcagataatcagagtggaggaagtacagccagcaaagggcgctatattcct
cctcatttaaggaaccgagaagctactaaaggtttctacgataaagacagttcagggtgg
agttctagcaaagataaggatgcatatagcagttttggatctcgcagtgattcaagaggg
aagtctagcttcttcagtgaccgtggaagtggatcaaggggaagatttgatgatcgtgga
cggagtgattatgacggcattggcagccgtgaccgaagtggctttggcaaatttgaacgt
ggtggaaacagtcgctggtgtgacaaatcagatgaagatgattggtcaaaaccactccca
ccaagtgaacgcttggaacaggaactcttttctggaggcaacactgggattaattttgag
aaatatgatgacattccagttgaggcaacaggcaacaactgtcctccacatattgaaagt
ttcagcgatgttgagatgggagaaattatcatgggaaacattgagcttactcgttatact
cgcccaactccagtgcaaaagcatgctattcctattatcaaagagaaaagagacttgatg
gcttgtgcccaaacaggatctggaaaaactgcagcatttctcttgcccatcttgagtcag
atttattcagatggtccaggcgaggctttgagggccatgaaggaaaatggaaggtatggg
cgccgcaaacaatacccaatctccttggtattagcaccaacgagagagttggcagtacag
atctacgaggaagccagaaaattttcataccgatctagagttcgtccttgcgtggtttat
ggtggtgccgatattggtcagcagattcgagacttggaacgtggatgccacttgttagta
gccactccaggacgtttggtggatatgatggaaagaggaaagattggattagacttttgc
aaatacttggtgttagatgaagctgatcggatgttggatatggggtttgagcctcagata
cgtagaatagttgaacaagatactatgcctccaaagggtgtccgccacactatgatgttt
agtgctacttttcctaaggaaatacagatgctggctcgtgatttcttagatgaatatatc
ttcttggctgtaggaagagttggctctacctctgaaaacatcacgcagaaagtagtttgg
gtcgaagaagcagacaaacggtcatttctgcttgaccttctaaatgcaacaggcaaggat
tcactgaccttagtgtttgtggagaccaaaaagggtgcagattctctggaggatttctta
taccatgaaggatatgcatgtacaagtatccatggagaccgttctcagagggatagggaa
gaggctcttcaccagttccgctcaggaaaaagcccaattctagtggctacagcagtagca
gcaagaggactggacatttcaaatgtgaaacatgttatcaattttgacttgccaagtgat
attgaagaatatgtacatcgcattggtcgtacaggacgtgtaggaaaccttggcctggca
acctcattctttaatgagaggaacataaacattactaaggatttgttggatcttcttgtt
gaagctaaacaagaagtgccatcttggttagaaaacatggcttatgaacaccactacaag
ggtagcagtcgtggacgttctaagagtagcagatttagcggagggtttggtgccagagac
taccgacaaagtagcggtgccagcagttccagcttcagcagcagccgtgcaagcagcagc
cgcagtggtggaggtggccacggcagcagcagaggattcggtggaggtggctatggaggc
ttttacaacagtgatggatatggaggaaattataactcccagggggttgactggtggggt
aactga

DBGET integrated database retrieval system