KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101041919
Entry
101041919         CDS       T04350                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X2
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq01524  Platinum drug resistance
sbq04012  ErbB signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04110  Cell cycle
sbq04115  p53 signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04218  Cellular senescence
sbq04630  JAK-STAT signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04934  Cushing syndrome
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05216  Thyroid cancer
sbq05217  Basal cell carcinoma
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05220  Chronic myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101041919 (CDKN1A)
   04630 JAK-STAT signaling pathway
    101041919 (CDKN1A)
   04066 HIF-1 signaling pathway
    101041919 (CDKN1A)
   04068 FoxO signaling pathway
    101041919 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    101041919 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101041919 (CDKN1A)
   04115 p53 signaling pathway
    101041919 (CDKN1A)
   04218 Cellular senescence
    101041919 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101041919 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    101041919 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101041919 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    101041919 (CDKN1A)
   05206 MicroRNAs in cancer
    101041919 (CDKN1A)
   05205 Proteoglycans in cancer
    101041919 (CDKN1A)
   05203 Viral carcinogenesis
    101041919 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101041919 (CDKN1A)
   05212 Pancreatic cancer
    101041919 (CDKN1A)
   05225 Hepatocellular carcinoma
    101041919 (CDKN1A)
   05226 Gastric cancer
    101041919 (CDKN1A)
   05214 Glioma
    101041919 (CDKN1A)
   05216 Thyroid cancer
    101041919 (CDKN1A)
   05220 Chronic myeloid leukemia
    101041919 (CDKN1A)
   05217 Basal cell carcinoma
    101041919 (CDKN1A)
   05218 Melanoma
    101041919 (CDKN1A)
   05211 Renal cell carcinoma
    101041919 (CDKN1A)
   05219 Bladder cancer
    101041919 (CDKN1A)
   05215 Prostate cancer
    101041919 (CDKN1A)
   05213 Endometrial cancer
    101041919 (CDKN1A)
   05224 Breast cancer
    101041919 (CDKN1A)
   05222 Small cell lung cancer
    101041919 (CDKN1A)
   05223 Non-small cell lung cancer
    101041919 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101041919 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101041919 (CDKN1A)
   05161 Hepatitis B
    101041919 (CDKN1A)
   05160 Hepatitis C
    101041919 (CDKN1A)
   05163 Human cytomegalovirus infection
    101041919 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101041919 (CDKN1A)
   05169 Epstein-Barr virus infection
    101041919 (CDKN1A)
   05165 Human papillomavirus infection
    101041919 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101041919 (CDKN1A)
   01522 Endocrine resistance
    101041919 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101041919
NCBI-ProteinID: XP_003923258
UniProt: A0A2K6SD11
LinkDB
Position
Unknown
AA seq 158 aa
MSEEIGDVRPNPSSSKARRCLFGPVDSEQLRRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKIYLSKGPLGGGRRPGTSPALLQGTAEEDHVDLSLSCTLMPHSGER
PEESPGGPGDSEGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 477 nt   +upstreamnt  +downstreamnt
atgtcagaagagattggggatgtccgtccgaacccatccagcagcaaggcccgccgctgc
ctcttcggcccagtggacagcgagcagctgagacgcgattgtgacgcgctgatggcaggc
tgcatccaggaggcccgtgagcgatggaacttcgactttgtcaccgagacaccactggag
ggtgacttcgcctgggagcgtgtgcggggccttggcctgcccaagatctacctttccaaa
gggcccctgggaggaggcaggcggcctggcacctcgcctgctctgctgcaggggacagcg
gaggaagaccacgtggacctgtcgctgtcttgcacccttatgcctcactcaggggagcgg
cctgaggagtccccaggtggacctggagactctgagggtcgaaaacggcggcagactagc
atgacagatttctaccactccaaacgccggctgatcttctccaagaggaagccctaa

DBGET integrated database retrieval system