KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101042074Help
Entry
101042074         CDS       T04350                                 

Gene name
GAA
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00052  Galactose metabolism
sbq00500  Starch and sucrose metabolism
sbq01100  Metabolic pathways
sbq04142  Lysosome
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101042074 (GAA)
   00500 Starch and sucrose metabolism
    101042074 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101042074 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101042074 (GAA)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101042074 (GAA)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101042074 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 Nodulin
Motif
Other DBs
NCBI-GeneID: 101042074
NCBI-ProteinID: XP_003931717
UniProt: A0A2K6S2R4
LinkDB All DBs
Position
Unknown
AA seq 949 aa AA seqDB search
MGVRQPPCPRQLLAVCALVSLATAVLLGHILLHDLLVVPRELGGSSPILKEPHSARQQGA
SRPGPRHDPGRPRAAPTRCDVPPNSRFDCAPDKTITQEQCEARGCCYVPAERVLRGAQMG
QPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLEVMMETENRLHFTI
KDPANRRYEVPLETPRVHSRAPSPLYSVEFSEEPFGLIVRRELGGRVLLNTTVAPLFFAD
QFLQLSTSLPSQYITGLAEHLSPLMLSTSWTKITLWNRDLAPTPGANLYGSHPFYLVLED
GGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYVFLGPEPKSVVRQYLDVVGYPFM
PPYWGLGFHLCRWGYSSTAITRQAVQNMTRAHFPLDVQWNDLDYMDGRRDFTFDKDAFPD
FPAMVRELHEGGRRYVMLVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKVWPG
STAFPDFTNPEALAWWEDMVVEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPSNELENPPY
VPGVVGGALQAATICASSRQFLSTHYNLHNLYGLTEAITSHRALVKARGARPFVISRSTF
AGHGRYAGHWTGDVWSSWEQLASSVSEILQFNLLGVPLVGADICGFLGNTSEELCVRWTQ
LGAFYPFMRNHNGLLNLPQEPYRFSEPAQQAMRNALALRYALLPHLYTLFHLAHVGGETV
ARPLFLEFPKDSSTWTVDHQLLWGAALLITPVLQAGKTEVTGYFPSGTWYNLQTVPIEAL
GSLPPPPAAPFEPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRRQPMAL
AVALTAGGEAQGELFWDDGESLGVLERGAYTQVTFLARSNTIMNELVRVSSEGAGLQLQK
VTVLGVATGPQQVLANGVPVSNFTYSPDTKVLDIPVSLSMGEQFLIRWS
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgaggcagccaccctgcccccgccagctgctggcagtctgcgccctcgtgtcc
ctggccacagccgtgctcctggggcacatcctgctccacgatttgctggtggttccccga
gagctgggcggctcctcccctatcctgaaggagcctcactcagctcgccagcagggagcc
agcaggccagggccccgccatgaccccggcaggcccagagcggcacccacacggtgcgac
gtgccccccaacagccgctttgactgtgcccctgacaagaccatcacccaggagcagtgt
gaggcccgtggctgctgctacgtccctgcggagcgggtgctgcggggtgcccagatgggg
cagccctggtgcttcttcccgcccagctaccccagctacaagctggagaacctgagctcc
tctgaaatgggctacacggccaccttgacccgaaccacccccaccttcttccccaaggac
atcctgaccttgcgactggaagtgatgatggagactgagaaccgcctccacttcacgatc
aaagatcccgctaacagacggtacgaggtgcccttggagacccctcgtgtccacagccgg
gcgccgtctccactctacagcgtggagttctccgaggagcccttcgggctgatcgtgcgc
cgggagctgggcggccgcgtgctgctgaacacgacggtggcaccgctgttcttcgcggac
cagttcctgcagctgtccacctcgctgccctcgcagtacatcacaggcctcgctgagcac
ctcagtcccctgatgctcagcaccagctggaccaagatcaccctgtggaaccgggacctc
gcacccacgccgggtgcaaacctctacgggtctcaccctttctacctggtgctggaggac
ggcgggtcagcacacggggtgttcctgctgaacagcaatgccatggacgtggtcctgcag
ccgagccccgccctcagctggaggtccacaggtgggatcctggatgtctacgtcttcctg
ggcccggagcccaagagcgtggtgcggcagtacctggacgttgtgggatacccgttcatg
ccgccgtactggggcctgggcttccacctgtgccgctggggctactcctccacggccatc
acccgccaggcggtgcagaacatgaccagggcccacttccccctggacgtgcagtggaac
gatctggactacatggacggccggagggacttcacgttcgacaaggacgccttccccgac
ttcccggccatggtgcgggagctacacgagggcggccggcgctacgtcatgctcgtggat
cctgccatcagcagctcaggccccgccgggagctacagaccgtatgacgagggtctgcgg
aggggggttttcatcaccaacgagaccggccagccgctgattgggaaggtgtggcccggg
tccactgccttccccgacttcaccaacccggaggccctggcctggtgggaggacatggtg
gttgagttccacgaccaggtgcccttcgacggcatgtggatcgacatgaacgagccttcc
aacttcatccggggctctgaggacggctgccccagcaatgagctggaaaacccgccctat
gtgcctggggtggttgggggcgccctccaggcggccaccatctgtgcctccagccgccag
ttcctctccacacactacaacctgcacaacctatacggcctgaccgaagccatcacctcg
cacagggcactggtgaaggctcgaggggctcgcccgtttgtgatctcccgctccaccttt
gcgggccatggccgatacgctggccactggaccggggacgtgtggagctcctgggagcag
ctggcctcctccgtgtccgaaatcctgcagtttaacctgctgggggtgcccctggtcggg
gcggacatctgcggcttcctgggcaacacttcggaggagctgtgcgtgcgctggacccag
ctgggcgccttctacccctttatgcggaaccacaacggcctgctcaatctgccccaggag
ccgtacaggttcagcgagccggcccagcaggccatgaggaacgccctggccctgcgctac
gcgctcctcccccacctctacacgctgttccacctggcgcacgtcggcggggagactgtg
gcccggcccctcttcctggagttccccaaggactccagcacctggactgtggaccaccag
ctgctctggggggcggccctgctcatcaccccagtgctccaggctgggaagaccgaagtg
actggctacttcccctcgggcacatggtacaacctgcagacggtgccaatagaggccctt
ggcagcctcccacctccacccgcagctcccttcgagccagccatccacagcgaagggcag
tgggtgacgctgccggcccccctggacaccatcaatgtccacctccgggcggggtacatc
atccccctacagggccccggcctcacaaccactgagtcccgccggcagcccatggccctg
gctgtggccctgaccgcgggtggggaggcccaaggcgagctgttctgggatgacggggag
agcctgggagtgctggagcggggggcctacacacaggtcaccttcctggccaggagcaac
acgatcatgaatgagctggtgcgtgtgagcagcgagggggctggcctgcagctgcagaag
gtgaccgtcctcggcgtggccacggggccccagcaagtcctcgccaacggggttcctgtc
tccaacttcacctatagccccgacaccaaggtcctggacatccctgtctcgctgtcgatg
ggagagcagtttctcatcaggtggtcttag

DBGET integrated database retrieval system