KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101042627
Entry
101042627         CDS       T04350                                 

Definition
(RefSeq) cytochrome P450 4A11
  KO
K07425  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00071  Fatty acid degradation
sbq00590  Arachidonic acid metabolism
sbq00830  Retinol metabolism
sbq01100  Metabolic pathways
sbq03320  PPAR signaling pathway
sbq04270  Vascular smooth muscle contraction
sbq04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101042627
   00590 Arachidonic acid metabolism
    101042627
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101042627
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101042627
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101042627
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101042627
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sbq00199]
    101042627
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     101042627
Cytochrome P450 [BR:sbq00199]
 Cytochrome P450, animal type
  CYP4 family
   101042627
SSDB
Motif
Pfam: p450 Proton_antipo_M
Other DBs
NCBI-GeneID: 101042627
NCBI-ProteinID: XP_003936922
UniProt: A0A2K6S7F9
LinkDB
Position
Unknown
AA seq 519 aa
MSVSVLSPSRLLGDISRILQLASLLILLLLLIKVAQFYLHRQWLLKVLQEFPCPPSHWLF
GHNQEYPQDQELQRIRKWVETFPSACPHWLWGSKARVQLYDPDYIKVILGRSDPKSHSTY
RFLPPFIGYGLLLLNGQTWFQHRRMLTPAFHYDVLKPYVEFMADSVRVMLDKWEELIGQD
SPLEVFQHVSLMTLDTIMKCAFSHQGSIQLDRDSQSYIQAIMDMNDLVFFRVRNAFYQND
IIYSLTTAGRWSHRACQLAHQHTDRVIQQRKAHLQEQGELEKVRKKRHLDFLDIVLLAKM
ENGNSLSDKDLRAEVDTFMFAGHDTTASGISWILYALATHPKHQQRCREEIQGLLGDGDS
ITWHHLDQMPYTTMCIKEALRLYPPVPGISRDLVTPITFPDGRSLPKGISVVLSIYGLHH
NPKVWPNPEVFDPSRFAPGSAQHSHAFLPFSGGARNCIGKQFAMNELKVAVALTLLRFEL
LPDPTRIPIPTPRIVLKSENGIHLHLRRLPNPCKDKDQL
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgagtgtctctgtgctgagccctagcagactcctgggtgatatctccaggatcctccaa
ttggcctccctgctcatcctgcttctgctgctgatcaaggtagcccagttctacctgcac
aggcagtggctgctcaaagtcctccaggagttcccatgccctccctcccactggctcttc
ggacacaaccaggagtatccacaggaccaggagctacaacggattcggaaatgggtggag
acattcccaagtgcctgtcctcattggctatggggaagcaaagctcgggtgcagctctat
gaccctgactatataaaggtgattctggggagatcagacccaaaatctcatagtacttac
agattcctgcctccatttattgggtacggcttgctcctgttgaatggccagacatggttc
cagcatcgacggatgctgacccccgccttccactatgacgtcctgaagccctacgtggag
ttcatggcagactctgtgagagtgatgctggacaaatgggaagagctaattggccaggac
tcccctctggaggtctttcagcatgtctccttgatgaccctggacaccatcatgaagtgt
gccttcagccaccagggcagcattcagttggacagggattctcagtcctacatccaggcc
attatggacatgaacgacctggtttttttccgtgtgaggaatgccttttaccagaatgac
atcatctacagcctgaccactgctggccgctggtcacatcgtgcctgccagctcgcccat
cagcacacagaccgagtgattcaacagaggaaggctcacctacaggagcagggggagctg
gagaaggtcaggaagaagaggcacttggatttcctggacatcgtcctcttggccaaaatg
gagaatgggaacagcttgtcagacaaggatctccgtgctgaggtggacacgttcatgttc
gcgggccatgacaccacagccagtgggatctcctggatcctctatgctctggccacacac
cccaagcatcagcagagatgccgggaggagatccagggcctcttgggggatggagactcc
atcacctggcaccacctggaccagatgccctataccaccatgtgcatcaaggaggcactt
agactctacccaccagtgccaggcattagcagagacctcgtcactcccataaccttccct
gatgggcgctccttgcccaaaggtatcagcgtcgtactttccatttacggccttcaccac
aaccccaaagtgtggcccaacccagaggtgtttgacccttcccgttttgcaccgggttct
gctcaacacagccacgctttcctgccattctcaggaggagcaaggaactgcattgggaag
caatttgccatgaatgagctgaaggtggccgtggccctgaccctgctccgctttgagctg
ctgcctgatcccaccaggatccccatccccacaccacgaattgtgctgaaatccgaaaat
ggaatccacctgcatctcaggaggctccctaacccttgtaaggacaaggaccagctttga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101050377
Entry
101050377         CDS       T04350                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cytochrome P450 4A11-like
  KO
K07425  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00071  Fatty acid degradation
sbq00590  Arachidonic acid metabolism
sbq00830  Retinol metabolism
sbq01100  Metabolic pathways
sbq03320  PPAR signaling pathway
sbq04270  Vascular smooth muscle contraction
sbq04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101050377
   00590 Arachidonic acid metabolism
    101050377
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101050377
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101050377
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101050377
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101050377
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sbq00199]
    101050377
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     101050377
Cytochrome P450 [BR:sbq00199]
 Cytochrome P450, animal type
  CYP4 family
   101050377
SSDB
Motif
Pfam: p450 DUF4194 RINT1_TIP1
Other DBs
NCBI-GeneID: 101050377
NCBI-ProteinID: XP_010345679
LinkDB
Position
Unknown
AA seq 351 aa
MKVILGRSDPKVTEISRLLAPXIGYGLPLLNRQKWRQHRRMLIPAFHFNILKPYVGLMVD
SVQAMLDKWEELIGQDSPLDVSQHVSLMTLDIIMKCAFSYQGSVQLDWDIQSYIQAIGDL
KNQFISCMGNVFHQNDTIYNLTPTGCSNHHTCQLVHQHTDQVIQLRKARLQEERELEKVR
RKRHLDFPDILLLAKMENGSSLSDKDLRAEVDTFMFGGHDTTASSISWIFCALATHPKVQ
QMCPEEIQSLLGNEASVTWNHLDQMPYTTICIKEALRLYPPVPSISRELITPVTFPDGRS
LPKGLKVSLSIYGLHHNPKVWPNPEVCDPSRFAPSSAQHSHAFLPFSGESR
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgaaggtgattctggggagatcagaccctaaagttacagaaatctccagactcctggct
ccctgaattgggtatggtttgcccctgctgaataggcagaagtggcgccagcaccggcgg
atgctgatcccagccttccattttaacatcctgaagccctatgtggggctcatggtggac
tccgtacaagcgatgctggacaaatgggaggagctcattggccaggactcccctctggat
gtctctcagcatgtctccttgatgactctggacatcatcatgaagtgtgccttcagttac
cagggcagcgtccagttggactgggatatccaatcctacatccaggccattggggacctc
aaaaaccagtttatttcctgcatgggcaatgtctttcatcagaatgacacaatctacaac
ctgacccctaccggctgctcaaaccaccatacctgccagcttgtccatcagcacacagat
caagtgatccaactgaggaaggctcgcctgcaggaggagcgggagctggagaaggtcagg
agaaagaggcatttggatttcccagacatcctccttttggccaaaatggagaatggcagc
agcttgtcagacaaggacctccgtgctgaggtggacacatttatgtttggaggacatgac
accacagccagcagcatctcctggatcttctgtgctctggccacacaccccaaggttcag
cagatgtgcccggaggagatccagagcctcctgggaaatgaagcctccgtcacctggaac
cacctggaccagatgccctacactaccatatgcatcaaggaggcactgagactctaccca
ccggtgccaagcattagcagagagctcatcactcctgtcaccttccctgatgggcgctca
ttgcccaaaggattgaaagtcagcctttccatttatggccttcaccacaacccgaaggtg
tggccaaacccagaggtgtgtgacccttcccgctttgctccgagttctgctcaacatagc
catgctttcctgcccttctctggagaatcaaggtga

DBGET integrated database retrieval system