KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101042765
Entry
101042765         CDS       T04350                                 

Gene name
FABP1
Definition
(RefSeq) fatty acid-binding protein, liver
  KO
K08750  fatty acid-binding protein 1, liver
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101042765 (FABP1)
  09154 Digestive system
   04975 Fat digestion and absorption
    101042765 (FABP1)
SSDB
Motif
Pfam: Lipocalin_7 Lipocalin Glyco_hydro_42M
Other DBs
NCBI-GeneID: 101042765
NCBI-ProteinID: XP_003942565
UniProt: A0A2K6SSC6
LinkDB
Position
Unknown
AA seq 127 aa
MNFTGKYQLQSQENFEPFMKAIGLPDELIQKGKDIKGVSEIVQNGKHFKLTITTGSKVIN
NEFTLGEECELETMTGEKVKAVVQMEGDNKLVTTFKNIKSVTELNGDIITSTMTLGNIVF
KRISKRI
NT seq 384 nt   +upstreamnt  +downstreamnt
atgaacttcaccggcaagtaccaactgcaaagccaggaaaactttgaacccttcatgaag
gcaatcggtctgccagacgagctcatccagaaggggaaggatatcaagggggtgtcagaa
atcgtgcagaatgggaagcacttcaagctcaccatcaccactgggtccaaagtgattaac
aacgagttcaccctgggagaggaatgtgagctggagacaatgacaggggagaaggtcaag
gcagtggttcagatggaaggtgacaataaactggtgacaactttcaaaaacatcaagtct
gtgaccgaactcaatggcgacataatcaccagtaccatgacattgggcaacattgtcttc
aagagaatcagcaagagaatttaa

DBGET integrated database retrieval system