KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101042808
Entry
101042808         CDS       T04350                                 

Gene name
RAC1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04145  Phagosome
sbq04151  PI3K-Akt signaling pathway
sbq04310  Wnt signaling pathway
sbq04360  Axon guidance
sbq04370  VEGF signaling pathway
sbq04380  Osteoclast differentiation
sbq04510  Focal adhesion
sbq04520  Adherens junction
sbq04530  Tight junction
sbq04613  Neutrophil extracellular trap formation
sbq04620  Toll-like receptor signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04662  B cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04666  Fc gamma R-mediated phagocytosis
sbq04670  Leukocyte transendothelial migration
sbq04722  Neurotrophin signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04972  Pancreatic secretion
sbq05014  Amyotrophic lateral sclerosis
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05100  Bacterial invasion of epithelial cells
sbq05132  Salmonella infection
sbq05135  Yersinia infection
sbq05163  Human cytomegalovirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
sbq05231  Choline metabolism in cancer
sbq05416  Viral myocarditis
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101042808 (RAC1)
   04014 Ras signaling pathway
    101042808 (RAC1)
   04015 Rap1 signaling pathway
    101042808 (RAC1)
   04310 Wnt signaling pathway
    101042808 (RAC1)
   04370 VEGF signaling pathway
    101042808 (RAC1)
   04071 Sphingolipid signaling pathway
    101042808 (RAC1)
   04024 cAMP signaling pathway
    101042808 (RAC1)
   04151 PI3K-Akt signaling pathway
    101042808 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101042808 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101042808 (RAC1)
   04520 Adherens junction
    101042808 (RAC1)
   04530 Tight junction
    101042808 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101042808 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101042808 (RAC1)
   04620 Toll-like receptor signaling pathway
    101042808 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    101042808 (RAC1)
   04662 B cell receptor signaling pathway
    101042808 (RAC1)
   04664 Fc epsilon RI signaling pathway
    101042808 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    101042808 (RAC1)
   04670 Leukocyte transendothelial migration
    101042808 (RAC1)
   04062 Chemokine signaling pathway
    101042808 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    101042808 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101042808 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    101042808 (RAC1)
   04380 Osteoclast differentiation
    101042808 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101042808 (RAC1)
   05205 Proteoglycans in cancer
    101042808 (RAC1)
   05203 Viral carcinogenesis
    101042808 (RAC1)
   05231 Choline metabolism in cancer
    101042808 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101042808 (RAC1)
   05212 Pancreatic cancer
    101042808 (RAC1)
   05211 Renal cell carcinoma
    101042808 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101042808 (RAC1)
   05020 Prion disease
    101042808 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    101042808 (RAC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101042808 (RAC1)
   05416 Viral myocarditis
    101042808 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101042808 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101042808 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101042808 (RAC1)
   05135 Yersinia infection
    101042808 (RAC1)
   05100 Bacterial invasion of epithelial cells
    101042808 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101042808 (RAC1)
   05163 Human cytomegalovirus infection
    101042808 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101042808 (RAC1)
   05169 Epstein-Barr virus infection
    101042808 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101042808 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101042808 (RAC1)
   04031 GTP-binding proteins [BR:sbq04031]
    101042808 (RAC1)
Membrane trafficking [BR:sbq04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    101042808 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    101042808 (RAC1)
  Macropinocytosis
   Ras GTPases
    101042808 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    101042808 (RAC1)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101042808 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   101042808 (RAC1)
  Exosomal proteins of colorectal cancer cells
   101042808 (RAC1)
  Exosomal proteins of bladder cancer cells
   101042808 (RAC1)
GTP-binding proteins [BR:sbq04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    101042808 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 101042808
NCBI-ProteinID: XP_010343168
UniProt: A0A2K6T9P7
LinkDB
Position
Unknown
AA seq 206 aa
MKNIIGIAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYD
RLRPLSYPQTVGETYGKDITSRGKDKPIADVFLICFSLVSPASFENVRAKWYPEVRHHCP
NTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLK
TVFDEAIRAVLCPPPVKKRKRKCLLL
NT seq 621 nt   +upstreamnt  +downstreamnt
atgaagaacataatcggaatagctgtaggtaaaacttgcctactgatcagttacacaacc
aatgcatttcctggagaatatatccctactgtctttgacaattattctgccaatgttatg
gtagatggaaaaccagtgaatctgggcttatgggatacagctggacaagaagattatgac
agattacgccccctatcctatccacaaacagttggagaaacgtacggtaaggatataacc
tcccggggcaaagacaagccgattgccgatgtgttcttaatttgcttttcccttgtgagt
cctgcatcatttgaaaatgtccgcgcaaagtggtatcctgaggtgcggcaccactgtccc
aacactcccatcatcctagtgggaactaaacttgatcttagggatgataaagacacgatc
gagaaactgaaggagaagaagctgactcccatcacctatccgcagggtctagccatggct
aaggagattggtgctgtaaaatacctggagtgctcggcgctcacacagcgaggcctcaag
acagtgtttgacgaagcgatccgagcagtcctctgcccacctcccgtgaagaagaggaag
aggaaatgcctgctgctgtaa

DBGET integrated database retrieval system