KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101042921
Entry
101042921         CDS       T04350                                 

Definition
(RefSeq) cholesterol 7-alpha-monooxygenase
  KO
K00489  cholesterol 7alpha-monooxygenase [EC:1.14.14.23]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00120  Primary bile acid biosynthesis
sbq00140  Steroid hormone biosynthesis
sbq01100  Metabolic pathways
sbq03320  PPAR signaling pathway
sbq04976  Bile secretion
sbq04979  Cholesterol metabolism
Module
sbq_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    101042921
   00140 Steroid hormone biosynthesis
    101042921
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101042921
  09154 Digestive system
   04976 Bile secretion
    101042921
   04979 Cholesterol metabolism
    101042921
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sbq00199]
    101042921
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.23  cholesterol 7alpha-monooxygenase
     101042921
Cytochrome P450 [BR:sbq00199]
 Cytochrome P450, animal type
  CYP7 family
   101042921
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 101042921
NCBI-ProteinID: XP_003935564
UniProt: A0A2K6SPD9
LinkDB
Position
Unknown
AA seq 504 aa
MLTISLIWGIAIAACCCLWLILGIRRRQTGEPPLENGLIPYLGCALQFGANPLEFLRANQ
RKHGHVFTCKLMGKYVHFITNPLSYHKVLCHGKYFDWKKFHFATSAKAFGHGSIDPRDGN
TTENINDTFIKTLQGSALNSLTESMMENLQRILRPPVFSNSKTSAWVTEGMYSFCYRVMF
EAGYLTLFGRDLTSQDTQRARILNNLDNFKQFDKVFPALVAGLPIHMFRTAHNAREKLAE
SLRHENLKKRGNVSELVSLRMFLNDTLSTFDDLEKAKTHLVILWASQANTIPATFWSLFQ
MIRNPEAMKAATEEVKRTLENAGQKVSLEGNPICLSQTQMNDLPVLDSIIKESLRLSSAS
LNIRTAKEDFTLLLEDGSYNIRKDDIIALYPQLMHLDPEIYPDPSTFKYDRYLDENGKTK
TTFYRNGLKLKCYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELVEGQAKCPPLD
QSRAGLGILPPLNDIEFKYKFKHL
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgttgaccatatctttgatttgggggattgctatagcagcatgctgttgtctatggctt
attcttggaataaggagaaggcaaacgggtgaaccgcctctagagaatgggttgattcca
tacctgggctgtgctctgcaatttggtgctaatcctcttgagttcctcagagcaaatcaa
aggaaacatggtcatgtttttacctgcaaactaatgggaaaatacgtccatttcatcaca
aatcccttgtcataccataaggtgttgtgccatggaaaatattttgattggaaaaaattt
cactttgctacctctgcaaaggcatttgggcatggaagcattgatccgagggatggaaat
accactgaaaacataaacgacactttcatcaaaaccctgcagggcagtgccttgaattcc
ctcacagaaagcatgatggaaaacctccagcgtatcctgagacctccggtcttctctaac
tcaaagacctctgcctgggtgacagaagggatgtattctttctgctaccgagtaatgttt
gaagctgggtatttaaccctctttggcagagatcttacaagtcaggacacacagagagca
cgtattctaaacaaccttgacaacttcaagcaattcgacaaagtctttccagctctggta
gcaggcctccccattcacatgtttaggactgcacataatgcccgagaaaaactggcagag
agcttgaggcacgagaacctcaaaaagaggggaaacgtctcagaactggtcagcctgcgc
atgtttctgaatgacacgttgtccaccttcgatgacctggagaaggccaagacacacctc
gtgatcctctgggcatcgcaagcaaacaccattccagcgactttctggagtttatttcaa
atgattaggaacccggaagcaatgaaagcagccactgaagaagtgaaaagaacactagag
aatgctggtcaaaaagtcagcttggaaggcaatcctatttgtttgagtcaaacgcaaatg
aatgacctgcccgtactagatagtataatcaaggagtcgctgaggctttccagtgcctcc
ctcaacatccggacagctaaggaggatttcactttgctccttgaggacggttcctacaac
atccgaaaagatgacatcatagctctttatccacagttaatgcacttagatccagaaatc
tacccagacccttctacttttaaatatgatcggtatcttgatgaaaatgggaagacaaag
actaccttctatcgtaatggactcaagttaaagtgttactacatgccctttgggtcagga
gctacaatatgtcctggaagattgttcgctatccatgaaatcaagcaatttttgattctg
atgctttcttatttcgaactggagcttgtggagggccaagctaaatgtccacctttggac
cagtcccgggcaggcctgggaattttgccaccattgaatgatattgagtttaaatataaa
ttcaagcatttgtga

DBGET integrated database retrieval system