KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101042952
Entry
101042952         CDS       T04350                                 

Gene name
FABP4
Definition
(RefSeq) fatty acid-binding protein, adipocyte
  KO
K08753  fatty acid-binding protein 4, adipocyte
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101042952 (FABP4)
   03320 PPAR signaling pathway
    101042952 (FABP4)
SSDB
Motif
Pfam: Lipocalin Lipocalin_7 HSP20
Other DBs
NCBI-GeneID: 101042952
NCBI-ProteinID: XP_010349193
UniProt: A0A2K6SR27
LinkDB
Position
Unknown
AA seq 132 aa
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFKLGQEFDEITADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECIM
KGVTSTRVYERA
NT seq 399 nt   +upstreamnt  +downstreamnt
atgtgtgatgcttttgtaggtacctggaaacttgtctccagtgaaaactttgatgattat
atgaaagaagtaggagtgggctttgccaccaggaaggtggctggcatggccaaacctaac
atgatcatcagtgtgaatggggatgtgattaccattaaatctgaaagcacctttaaaaat
actgagatttccttcaaactgggccaggaatttgacgaaattaccgcagatgacaggaaa
gtcaagagcaccataaccttagatggaggtgtcctggtacatgtgcagaaatgggatgga
aaatcaaccaccataaagagaaaacgagaggatgataaactggtggtggaatgcatcatg
aaaggcgtcacttccaccagagtttatgagagagcataa

DBGET integrated database retrieval system