KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043245
Entry
101043245         CDS       T04350                                 

Gene name
TRAF3
Definition
(RefSeq) TNF receptor-associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04064  NF-kappa B signaling pathway
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04657  IL-17 signaling pathway
sbq04668  TNF signaling pathway
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101043245 (TRAF3)
   04668 TNF signaling pathway
    101043245 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101043245 (TRAF3)
   04621 NOD-like receptor signaling pathway
    101043245 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    101043245 (TRAF3)
   04657 IL-17 signaling pathway
    101043245 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101043245 (TRAF3)
   05203 Viral carcinogenesis
    101043245 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101043245 (TRAF3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101043245 (TRAF3)
   05160 Hepatitis C
    101043245 (TRAF3)
   05171 Coronavirus disease - COVID-19
    101043245 (TRAF3)
   05164 Influenza A
    101043245 (TRAF3)
   05162 Measles
    101043245 (TRAF3)
   05168 Herpes simplex virus 1 infection
    101043245 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101043245 (TRAF3)
   05169 Epstein-Barr virus infection
    101043245 (TRAF3)
   05165 Human papillomavirus infection
    101043245 (TRAF3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 ATG16 Crescentin zf-C3HC4_2 MPS2 Tropomyosin_1 Spc7 Cast zf-RING_4 Spc29 KxDL T3SSipB FliJ Exonuc_VII_L BLOC1_2 DUF1664 GAS SPATA24 DUF3450 V_ATPase_I
Other DBs
NCBI-GeneID: 101043245
NCBI-ProteinID: XP_010342258
UniProt: A0A2K6S4L5
LinkDB
Position
Unknown
AA seq 568 aa
MESSKKMDSPGTLQTNPPLKLHADRSAGTPIFVPEQGGYKEKFVKAVEDKYKCEKCRLVL
CSPKQTECGHRFCESCMASLLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNE
SRGCSEQLTLGHLLVHLKNDCQFEELPCVRADCKEKVLRKDLRDHVEKACKYREATCSHC
KSQVPMITLQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggagtccagtaagaagatggactcgcctggcacgctgcagaccaacccgccactgaag
ctgcacgctgaccgcagtgccgggacaccgatttttgtccctgagcaaggaggctacaag
gagaagtttgtgaaggccgtggaggacaagtacaagtgtgagaagtgccgcctggtgctg
tgcagcccgaagcagaccgagtgtggccaccgcttctgcgagagctgcatggcctctctg
ctgagctcttcaagtccaaaatgtaccgcgtgtcaagagagcatcgttaaagataaggtg
tttaaggataattgctgcaagagagaaattctagctcttcagatctactgtcggaatgaa
agccggggttgctcagagcagttaacgctggggcatctgttggtgcatttaaaaaatgat
tgccagtttgaagaacttccatgtgtgcgtgctgactgcaaagaaaaggtcttgaggaaa
gaccttcgagaccatgtggagaaggcgtgtaaataccgggaagccacctgcagccactgc
aagagtcaggttccgatgatcacgctgcagaaacatgaagacacggactgtccctgcgtg
gtggtgtcctgccctcacaagtgcagcgtccagactctcctgaggagcgagttgagtgca
cacttgtcagagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgtt
tttcaggggacaaaccagcagatcaaggcccacgaggccagctccgccgtgcagcacgtg
aacctgctgaaggagtggagtaactcgctcgagaagaaggtttccttgctacagaatgaa
agtgtagaaaaaaacaagagcatacaaagtttgcacaatcagatatgtagctttgaaatt
gaaattgagagacagaaggaaatgcttcgaaataatgaatccaaaatccttcatttacag
cgagtgatagacagccaagcggagaaactgaaggagctggacaaggagatccggcccttc
cggcagaactgggaggaagcagacagcatgaagagcagcgtggagtccctccagaaccgc
gtgaccgagttggagagcgtggacaagagcgcggggcaggtggctcggaacacaggcctg
ctggagtcccagctgagccggcacgaccagatgctgagcgtgcacgacatccgcctggct
gacatggacctgcgcttccaggtcctggagaccgccagctacaacggcgtgctcatctgg
aagattcgcgactacaagcggcggaagcaggaggcagtcatggggaagacactgtccctc
tacagccagcctttctacaccggctactttggctataagatgtgcgccagggtctacctg
aatggggacgggatgggaaaggggacgcacttgtcgctgttttttgtcatcatgcgtgga
gaatatgacgccctgcttccttggccgtttaagcagaaagtgacactcatgttgatggat
caggggtcctctcggcgtcacctgggagacgcgttcaagcccgaccccaacagcagcagc
ttcaagaagcccaccggagagatgaatatcgcctctggctgcccggtctttgtggcccaa
actgttctagaaaatgggacatatattaaagatgatacaatttttattaaagtcatagtg
gatacttcggatctgcccgatccctga

DBGET integrated database retrieval system