KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043327
Entry
101043327         CDS       T04350                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1 isoform X1
  KO
K02105  catenin beta 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04015  Rap1 signaling pathway
sbq04310  Wnt signaling pathway
sbq04390  Hippo signaling pathway
sbq04510  Focal adhesion
sbq04520  Adherens junction
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04670  Leukocyte transendothelial migration
sbq04916  Melanogenesis
sbq04919  Thyroid hormone signaling pathway
sbq04934  Cushing syndrome
sbq05010  Alzheimer disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05100  Bacterial invasion of epithelial cells
sbq05132  Salmonella infection
sbq05160  Hepatitis C
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05210  Colorectal cancer
sbq05213  Endometrial cancer
sbq05215  Prostate cancer
sbq05216  Thyroid cancer
sbq05217  Basal cell carcinoma
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05412  Arrhythmogenic right ventricular cardiomyopathy
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101043327 (CTNNB1)
   04310 Wnt signaling pathway
    101043327 (CTNNB1)
   04390 Hippo signaling pathway
    101043327 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101043327 (CTNNB1)
   04520 Adherens junction
    101043327 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101043327 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101043327 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101043327 (CTNNB1)
   04916 Melanogenesis
    101043327 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101043327 (CTNNB1)
   05205 Proteoglycans in cancer
    101043327 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101043327 (CTNNB1)
   05225 Hepatocellular carcinoma
    101043327 (CTNNB1)
   05226 Gastric cancer
    101043327 (CTNNB1)
   05216 Thyroid cancer
    101043327 (CTNNB1)
   05217 Basal cell carcinoma
    101043327 (CTNNB1)
   05215 Prostate cancer
    101043327 (CTNNB1)
   05213 Endometrial cancer
    101043327 (CTNNB1)
   05224 Breast cancer
    101043327 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101043327 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    101043327 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101043327 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101043327 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101043327 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101043327 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    101043327 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101043327 (CTNNB1)
   05163 Human cytomegalovirus infection
    101043327 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101043327 (CTNNB1)
   05165 Human papillomavirus infection
    101043327 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 101043327
NCBI-ProteinID: XP_010339764
UniProt: A0A2K6U1R6
LinkDB
Position
Unknown
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctactcaagctgatttgatggagttggacatggccatggaaccagacagaaaagca
gctgttagtcactggcagcaacagtcctacctggactctggaatccattctggcgccact
accacagctccttctctgagtggtaaaggcaatcctgaggaagaggatgtggatacctcc
caagtcctgtatgagtgggaacaggggttttctcagtccttcactcaagaacaagtagct
gatattgatggacagtatgcaatgactcgagctcagagggtacgcgctgccatgttccct
gagacattagatgagggcatgcagatcccatctacacagttcgatgctgctcatcccacc
aatgtccagcgtttggctgaaccatcacagatgctgaaacatgcagttgtaaacttgatt
aactatcaagatgatgccgaacttgccacacgtgcaatccctgaactgacaaaactgctc
aatgatgaggaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacatgctatcatgcgttctcctcagatggtgtctgctattgtacgt
accatgcagaatacaaatgatgtagaaacagcccgttgtactgctgggaccttgcacaac
ctttcccatcatcgggagggcttgctggccatctttaaatctggaggcattcctgccctg
gtgaaaatgcttggttcaccagtggattctgtgttgttttatgccattacaactctccac
aaccttttactacaccaagaaggagccaaaatggcagtgcgtttagctggtgggctgcag
aaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacgacagactgc
cttcaaattttagcttacggcaaccaagaaagcaagctgattatactggccagtggtgga
ccccaagctttagtaaatataatgaggacctacacttatgaaaaactactgtggaccaca
agcagagtgctgaaggtgctatctgtctgctctagtaataagccggctattgtagaagct
ggtggaatgcaagctttagggcttcacctgacagatccaagtcaacgtcttgttcagaac
tgtctttggactctcaggaatctttcagatgctgcaactaaacaggaagggatggaaggt
ctccttgggactcttgttcagcttctgggttcagatgatataaatgtggtcacctgtgcg
gctggaattctttctaacctgacttgcaataattataagaacaagatgatggtctgccaa
gtgggtggtatagaggctcttgtgcgtactgtccttcgggctggggacagggaggacatc
actgagcctgccatctgtgcccttcgccatctgaccagccgacaccaagaggcagagatg
gctcagaacgcagttcgccttcactatggactcccagttgtggttaagctcctacatcca
ccatcccattggcctctgataaaggctaccgttggattgattcgaaatcttgccctttgt
ccagcaaatcatgctcctttgcgtgagcagggtgccattccacgactagtccagttgctc
gttcgtgcgcatcaggacacccagcgccgtacctccatgggtgggacacagcagcagttc
gtggagggagtccgcatggaagaaatagttgaaggttgtactggagcccttcatatccta
gctcgggatgttcacaaccgaattgtcatcagaggactaaataccattccattgtttgtg
cagctgctttattctcccattgaaaatatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaagctgcagaagctattgaagccgagggggccacagctcctctg
acagagttacttcactctaggaatgaaggtgtggcgacgtatgcagctgctgttttgttc
cgaatgtctgaggacaagccacaggattacaagaaacggctttcagttgagctgaccagt
tctctcttcagaacagagccaatggcttggaatgagactgctgatcttggacttgatatt
ggtgcccagggagaaccccttggatatcgccaggatgaccctagctatcgttcttttcac
tctggtggatatggccaggatgccttgggtatggaccccatgatggagcatgagatgggt
ggccaccaccctggtgctgactatcccgttgatgggctgccagatctggggcatgcccag
gacctcatggatgggctgcctccaggtgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system