KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043415
Entry
101043415         CDS       T04350                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2 isoform X2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq01524  Platinum drug resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04020  Calcium signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04510  Focal adhesion
sbq04520  Adherens junction
sbq04530  Tight junction
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05215  Prostate cancer
sbq05219  Bladder cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05226  Gastric cancer
sbq05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101043415 (ERBB2)
   04012 ErbB signaling pathway
    101043415 (ERBB2)
   04066 HIF-1 signaling pathway
    101043415 (ERBB2)
   04020 Calcium signaling pathway
    101043415 (ERBB2)
   04151 PI3K-Akt signaling pathway
    101043415 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101043415 (ERBB2)
   04520 Adherens junction
    101043415 (ERBB2)
   04530 Tight junction
    101043415 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101043415 (ERBB2)
   05206 MicroRNAs in cancer
    101043415 (ERBB2)
   05205 Proteoglycans in cancer
    101043415 (ERBB2)
   05230 Central carbon metabolism in cancer
    101043415 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101043415 (ERBB2)
   05226 Gastric cancer
    101043415 (ERBB2)
   05219 Bladder cancer
    101043415 (ERBB2)
   05215 Prostate cancer
    101043415 (ERBB2)
   05213 Endometrial cancer
    101043415 (ERBB2)
   05224 Breast cancer
    101043415 (ERBB2)
   05223 Non-small cell lung cancer
    101043415 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101043415 (ERBB2)
   01524 Platinum drug resistance
    101043415 (ERBB2)
   01522 Endocrine resistance
    101043415 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101043415 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101043415 (ERBB2)
   04090 CD molecules [BR:sbq04090]
    101043415 (ERBB2)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101043415 (ERBB2)
Protein kinases [BR:sbq01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   101043415 (ERBB2)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101043415 (ERBB2)
CD molecules [BR:sbq04090]
 Proteins
  101043415 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like CBP_BcsF
Other DBs
NCBI-GeneID: 101043415
NCBI-ProteinID: XP_003942891
UniProt: A0A2K6U1I8
LinkDB
Position
Unknown
AA seq 1254 aa
MELAAWCRWGLLLSLLPPGAAGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNG
DPLDNTTPVTGASPGGLRELQLRSLTEILKGGVWIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPVCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSAN
IQEFVGCKKIFGSLAFLPESFDGDPASNTVPLQPEQLHVFETLEEITGYLYISAWPDSLP
DLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNARLCFVHTV
PWDNLFRNPHQALLHTANRPEHECVGKDLACHPLCARGHCWGPGPTQCVNCSQFLRGQEC
VEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCSGPEADQCVACAHYKDSPFCVARC
PSGVKPDLSYMPIWKFPDEEGTCQPCPINCTHSCVDLDDKGCPAEQRASPLTSIISAVVG
ILLVMVLGLLLGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFSPDPAPGAGGMAHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPRTPSEG
AGSDVFDGDLGMGAAKGLQSFPPHDPSPLQRYSEDPTVPPPSETDGYVAPLTCSHQPEYV
NQPDVRPQPSSPQEGPLPPARPAGATLERPKTLSPGKNGVIKDVFAFGSAVENPEYLAPR
VGAAPQPHPPAFSPAFDNLYYWDQDPSERGAPPSTFEGTPTAENLEYLGLDVPV
NT seq 3765 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgctgggggctcctcctctccctcttgccccccggagcc
gcgggcacccaagtgtgcaccggcacagacatgaagctgcggctccctgccagtcccgag
actcacctggacatgctccgccacctctaccagggctgccaggtggtgcagggtaacctg
gaactcacctacctgcccaccaatgccagcctctccttcctgcaggatatacaggaggtg
cagggctacgtgctcatcgcccacaaccaagtgagacaggtcccgctgcagaggctgcgg
attgtacgaggcacccagctctttgaggacaactatgccctggccgtgctagacaacgga
gaccctctggacaataccacccctgtcacaggggcctccccaggaggcctgcgggagctg
cagcttcgaagcctcacagagatcttgaagggaggggtctggatccagcggaacccccag
ctctgctaccaggacacgattttgtggaaggacatcttccacaagaacaaccagctggct
ctcacactgatagacaccaaccgctctcgggcctgccacccctgttctccggtgtgtaag
ggctcccgctgctggggagagagttctgaggactgtcagagcctgacacgcactgtctgt
gctggtggctgtgcccgctgcaagggcccgctgcccactgactgctgccatgagcagtgt
gctgccggctgcacaggccccaagcactccgactgcctggcctgcctccacttcaaccac
agtggcatctgtgagctgcactgcccagccctggtcacctacaacacagacacctttgag
tccatgcccaaccctgagggccggtatacatttggcgccagctgtgtgactgcctgtccc
tacaactacctatcaacggatgtgggatcctgcacgcttgtctgccccctgcacaaccaa
gaggtgacagcggaggacggaacacagcggtgtgagaagtgcagcaagccctgtgcccga
gtgtgctatggtctgggcatggagcacttgcgagaggtgagggcagtcaccagtgccaat
atccaggagtttgtgggctgcaagaagatcttcgggagcctggcatttctgccggagagc
tttgatggggacccagcctccaacaccgtccccctacagccagagcagctccacgtgttt
gagactctggaagagatcacaggttacctgtatatctcagcatggccagacagcctgcct
gacctcagcgtcttccagaacctgcaagtaatccgaggacgaattctgcacaatggcgcc
tactcgctgaccctgcaagggctgggcatcagctggctggggctgcgctcactgcgggaa
ctgggcagtggactggccctcatccaccacaatgcccgcctctgcttcgtgcacacggtg
ccctgggacaatctcttccggaacccgcaccaagccctgctccacactgccaaccggcca
gagcatgagtgtgtgggcaaggacctggcctgccacccgctgtgtgcccgagggcactgc
tggggtcccgggcccacccagtgtgtcaactgcagccagttccttaggggccaggagtgc
gtggaggaatgccgagtactgcaggggctccccagggagtatgtgaatgccagacactgt
ttgccgtgccaccctgagtgtcagccccagaatggctcagtgacctgttctggaccggag
gctgaccagtgtgtggcctgtgcccactacaaggactctcctttctgcgtggcccgctgc
cctagcggtgtgaaacctgacctctcctacatgcccatctggaagtttccagatgaggag
ggcacatgccagccttgccccatcaactgcacccactcctgtgtggacctggatgacaag
ggctgccccgccgagcagagagccagccctctgacgtccatcatctctgcggtggtgggc
attctgctggtcatggtcttggggctgctccttgggatcctcatcaagcgacggcagcag
aagatccggaagtacacaatgcggaggctgctgcaggaaaccgagctggtggagccgctg
acaccgagcggagccatgcccaaccaggcacagatgcggatcctgaaagagactgagctg
aggaaggtgaaggtgcttggatccggagcttttggcacagtctacaagggaatctggatc
cctgatggggagaatgtgaaaattccagtggccatcaaagtgttgagagaaaacacatcc
cctaaagccaacaaagaaatcttagacgaagcatacgtgatggctggtgtgggctcccca
tatgtctcccgcctcctgggcatctgcctgacatccacagtgcaactggtgacacagctt
atgccctatggctgcctcttagaccatgtccgggaacaccgaggacgcctgggctcccag
gacctgctgaactggtgtgtgcagattgccaaggggatgagctacctggaggatgtgcgg
ctcgtacacagggacttggctgctcggaacgtgctggtcaagagtcccaaccatgtcaag
attacagacttcgggctagctcggctgctggacattgatgagacagaataccatgcagat
gggggcaaggtgcccatcaagtggatggcattggagtccattctccgccggcggttcacc
caccagagtgatgtgtggagttacggtgtgactgtgtgggagctgatgacttttggggcc
aaaccttacgatgggatcccagcgcgggagatccctgacctgctggagaagggggagcgg
ctgccccagccccccatctgcaccattgatgtctacatgatcatggtcaaatgttggatg
attgactctgaatgtcggccaagattccgggagttggtgtctgaattctcccgaatggcc
agggacccccagcgctttgtggtcatccagaatgaggacttgggcccggccagtcccttg
gatagcaccttctaccgctcactgctggaggacgatgacatgggggacctggtggatgcc
gaggagtatctggtgccccagcagggcttcttcagcccagaccctgccccaggtgctggg
ggcatggcccaccacaggcaccgcagctcatccactaggagtggcggtggggacctgacg
ctagggctggagccctctgaagaggaggcccccaggtctccacggacaccctccgaaggt
gctggctccgatgtatttgatggtgacctgggaatgggggcagccaaggggctgcaaagc
ttccccccacacgaccctagccctctacagcggtacagtgaggaccccacagtacccccg
ccctctgagactgatggctacgttgcccccctgacctgcagccaccagcctgaatatgtg
aaccagccagatgttcggccacagccctcttcgccccaagagggtcctctgcctcctgcc
cgacctgctggtgccactctggaaaggcccaagactctctccccagggaagaatggggtc
atcaaagacgtttttgcctttgggagtgccgtggagaaccccgagtacttggcaccccgg
gtaggagctgcccctcagccccaccctcctgccttcagcccagccttcgacaacctctat
tattgggaccaggacccatcagagcggggggctccacccagcactttcgaagggacccct
acggcagagaacctagagtacctgggtctcgacgtaccggtgtga

DBGET integrated database retrieval system