KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043425
Entry
101043425         CDS       T04350                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01523  Antifolate resistance
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04062  Chemokine signaling pathway
sbq04064  NF-kappa B signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04380  Osteoclast differentiation
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04657  IL-17 signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04668  TNF signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq05132  Salmonella infection
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05212  Pancreatic cancer
sbq05215  Prostate cancer
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05222  Small cell lung cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05340  Primary immunodeficiency
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101043425 (IKBKG)
   04014 Ras signaling pathway
    101043425 (IKBKG)
   04064 NF-kappa B signaling pathway
    101043425 (IKBKG)
   04668 TNF signaling pathway
    101043425 (IKBKG)
   04151 PI3K-Akt signaling pathway
    101043425 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101043425 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101043425 (IKBKG)
   04621 NOD-like receptor signaling pathway
    101043425 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    101043425 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    101043425 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    101043425 (IKBKG)
   04660 T cell receptor signaling pathway
    101043425 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    101043425 (IKBKG)
   04659 Th17 cell differentiation
    101043425 (IKBKG)
   04657 IL-17 signaling pathway
    101043425 (IKBKG)
   04662 B cell receptor signaling pathway
    101043425 (IKBKG)
   04062 Chemokine signaling pathway
    101043425 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101043425 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101043425 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101043425 (IKBKG)
   05203 Viral carcinogenesis
    101043425 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101043425 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101043425 (IKBKG)
   05221 Acute myeloid leukemia
    101043425 (IKBKG)
   05220 Chronic myeloid leukemia
    101043425 (IKBKG)
   05215 Prostate cancer
    101043425 (IKBKG)
   05222 Small cell lung cancer
    101043425 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    101043425 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101043425 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101043425 (IKBKG)
   05135 Yersinia infection
    101043425 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101043425 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    101043425 (IKBKG)
   05161 Hepatitis B
    101043425 (IKBKG)
   05160 Hepatitis C
    101043425 (IKBKG)
   05171 Coronavirus disease - COVID-19
    101043425 (IKBKG)
   05164 Influenza A
    101043425 (IKBKG)
   05162 Measles
    101043425 (IKBKG)
   05168 Herpes simplex virus 1 infection
    101043425 (IKBKG)
   05163 Human cytomegalovirus infection
    101043425 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101043425 (IKBKG)
   05169 Epstein-Barr virus infection
    101043425 (IKBKG)
   05165 Human papillomavirus infection
    101043425 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101043425 (IKBKG)
   05142 Chagas disease
    101043425 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101043425 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101043425 (IKBKG)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101043425 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 Bacillus_HBL
Other DBs
NCBI-GeneID: 101043425
NCBI-ProteinID: XP_010330107
LinkDB
Position
Unknown
AA seq 468 aa
MTPEAGSRDFDSGEGKGDRGTETFSQCGGPTSAHSLPLPPFSHLTDSADRSRHLWKSQSC
EMVQPSGGPAAGHDVLREESPLGKPAMLHLPSEQAAPETLQRCLEENQELRDAIRQSNQM
LRERCEELLHFQASQREEKEFLMCKFQEARKLVERLSLEKLNLKRQKEQAVREVEHLKRC
QQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRAREASEQVRQLESEREAL
QQQHSVQVDQLRMQAQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVS
SERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKMVMETVPVLKAQADIYKAD
FQAERQAREKLAEKKELLQEQLEQLQREYSKLKATCQESARIEDMRKRHGEVSQAPLPAA
PAHHSFLLAQSNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgacaccggaagccggaagcagggatttcgacagcggagaaggaaagggcgaccgcgga
actgagaccttctcgcagtgcgggggccctaccagcgctcacagtctgccgcttccaccc
ttctcacatctgacggactctgctgacaggagcagacacctctggaagagccagtcgtgt
gagatggtgcagcccagtggcggcccagcagcaggtcacgacgtgctgcgtgaagagtct
cctctggggaagccggccatgctgcacctgccttcagagcaggccgctcctgagaccctc
cagcgctgcctggaggagaaccaagagcttcgagatgccatccggcagagcaaccagatg
ctgcgggagcgctgtgaggagcttctgcatttccaagccagccagagggaagagaaggag
ttcctcatgtgcaaattccaggaggccaggaaactggtggagagactcagcctggagaag
ctcaacctgaagaggcagaaggagcaggccgtgcgggaggtggagcacctgaagagatgc
cagcagcagatggctgaggacaaggcctctgtgaaagcccaggtgacgtccttgctcggg
gagctccaggagagccagagtcgcttggaggctgccactaaggaatgccaggctctggag
ggtcgggcccgggaggccagcgagcaggtgcggcagctggagagcgagcgcgaggcactg
cagcagcagcacagcgtgcaggtggaccagctgcgcatgcaggcccagagtgtggaggcc
gcgctccgcatggagcgacaggccgcctcggaggagaagcggaagctggctcagttgcag
gtggcctatcaccagctcttccaagaatatgacaaccacatcaagagcagtgtggtgagc
agcgagcggaagcgaggaatgcagctggaagatctcaagcagcagctccagcaggctgag
gaggccctggtggccaaacaggaggtgatcgataagctgaaggaggaggccgagcagcac
aagatggtgatggagactgttccagtgctgaaggcgcaggcggacatctacaaggcagac
ttccaggctgagaggcaggcccgggagaagctggctgagaagaaggagctgttgcaggag
cagctggagcagttgcagagggagtacagcaaattgaaggccacctgtcaggagtcggcc
aggattgaggacatgaggaagcggcatggagaggtctcccaggcccccttgcctgctgcc
cccgcccaccactcctttctcctggctcagtccaaccagaggaggagcccccctgaggag
ccgcctgacttctgctgtcccaagtgccagtatcaggcccctgatatggacaccctgcag
atacacgtcatggagtgcattgagtag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044006
Entry
101044006         CDS       T04350                                 

Gene name
CHUK
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01523  Antifolate resistance
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04062  Chemokine signaling pathway
sbq04064  NF-kappa B signaling pathway
sbq04068  FoxO signaling pathway
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04380  Osteoclast differentiation
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04657  IL-17 signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04668  TNF signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq05010  Alzheimer disease
sbq05132  Salmonella infection
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05212  Pancreatic cancer
sbq05215  Prostate cancer
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05222  Small cell lung cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101044006 (CHUK)
   04014 Ras signaling pathway
    101044006 (CHUK)
   04064 NF-kappa B signaling pathway
    101044006 (CHUK)
   04668 TNF signaling pathway
    101044006 (CHUK)
   04068 FoxO signaling pathway
    101044006 (CHUK)
   04151 PI3K-Akt signaling pathway
    101044006 (CHUK)
   04150 mTOR signaling pathway
    101044006 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101044006 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101044006 (CHUK)
   04621 NOD-like receptor signaling pathway
    101044006 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    101044006 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    101044006 (CHUK)
   04625 C-type lectin receptor signaling pathway
    101044006 (CHUK)
   04660 T cell receptor signaling pathway
    101044006 (CHUK)
   04658 Th1 and Th2 cell differentiation
    101044006 (CHUK)
   04659 Th17 cell differentiation
    101044006 (CHUK)
   04657 IL-17 signaling pathway
    101044006 (CHUK)
   04662 B cell receptor signaling pathway
    101044006 (CHUK)
   04062 Chemokine signaling pathway
    101044006 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101044006 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101044006 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101044006 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101044006 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101044006 (CHUK)
   05221 Acute myeloid leukemia
    101044006 (CHUK)
   05220 Chronic myeloid leukemia
    101044006 (CHUK)
   05215 Prostate cancer
    101044006 (CHUK)
   05222 Small cell lung cancer
    101044006 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101044006 (CHUK)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101044006 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101044006 (CHUK)
   05135 Yersinia infection
    101044006 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101044006 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    101044006 (CHUK)
   05161 Hepatitis B
    101044006 (CHUK)
   05160 Hepatitis C
    101044006 (CHUK)
   05171 Coronavirus disease - COVID-19
    101044006 (CHUK)
   05164 Influenza A
    101044006 (CHUK)
   05162 Measles
    101044006 (CHUK)
   05168 Herpes simplex virus 1 infection
    101044006 (CHUK)
   05163 Human cytomegalovirus infection
    101044006 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101044006 (CHUK)
   05169 Epstein-Barr virus infection
    101044006 (CHUK)
   05165 Human papillomavirus infection
    101044006 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101044006 (CHUK)
   05142 Chagas disease
    101044006 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101044006 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101044006 (CHUK)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     101044006 (CHUK)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101044006 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 101044006
NCBI-ProteinID: XP_010331492
UniProt: A0A2K6T4T4
LinkDB
Position
Unknown
AA seq 746 aa
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMSGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSECVNYIVRDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGAVTPQTSAWLPPTSTEHNHSLSCVVTPQDGETSAQMIEENLNCLDLL
STIIHEANEEEQGSSMMSLDWSWLTE
NT seq 2241 nt   +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggccgggcgcgggcgggccctgggagatgcgggagcgg
ctgggcaccggcggcttcgggaacgtctgtctgtaccagcatcgggaacttgatctcaaa
atagcaattaagtcttgtcgcctagagctaagtaccaaaaacagagaacggtggtgtcat
gaaatccagattatgaagaagttgaaccatgccaatgttgtaaaggcctgtgatgttcct
gaagaattgaatattttgattcatgatgtacctcttctagcaatggaatactgttctgga
ggagatctccgaaagctgctcaacaaaccagaaaattgttgtggacttaaagaaagccag
atactttctttactaagtgatatagggtctggcattcgatatttgcatgaaaacaaaatt
atacatcgagatctaaaacctgaaaacatagttcttcaggatgttggtggaaagataata
cataaaataattgatctaggatatgccaaagatgttgatcaaggaagtctgtgtacatct
tttgtgggaacactgcagtatctggccccagagctctttgagaataagccttacacagcc
actgttgattattggagctttgggacgatggtatttgaatgtattgctggatataggcct
tttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgtgaagagatgtcaggagaagttcggtttagtagccatttacctcaa
ccaaatagcctttgtagtttaatagtagaacccatggaaaactggctacagttgatgttg
aattgggaccctcagcagagaggaggacctgttgaccttactttgaagcagccaagatgt
tttgtattaatggatcacattttgaatttgaagatagtacacatcctaaatatgacttct
gcaaagataatttcttttctgttaccacctgatgaaagtcttcattcactacagtctcgt
attgagcgtgaaactggaataaatactggttctcaagagcttctttcagagacaggaatt
tctctggatcctcggaaaccagcctctcaatgtgttctagatggagttagaggctgtgat
agttatatggtttatttgtttgataaaagtaaaactgtatatgaagggccatttgcttcc
agaagtttatctgaatgtgtaaattatattgtacgggacagcaaaatacagcttccaatt
atacagctgcgtaaagtatgggctgaagctgtgcactatgtgtctggactaaaagaagac
tacagcaggctttttcagggacaaagagcagcaatgttaagtcttcttagatataatgct
aacttaacaaaaatgaagaacactttaatctcagcatcacaacaactgaaagctaaattg
gagttttttcacaaaagcattcagcttgacttggaaagatatagtgagcagatgacctat
gggatatcttcagaaaaaatgctaaaagcgtggaaagaaatggaagaaaaggccatccac
tatgctgaggttggtgtcattggatacctggaggatcagatcatgtctttgcatgctgaa
atcatggagctgcagaagagcccctatggaagacgtcagggagacttgatggaatctctg
gaacagcgagccattgatctatataagcagttaaaacacagaccttcagatcactcctac
agtgacagtacagagatggtgaaaatcattgtgcacactgtgcagagtcaggaccgtgtg
ctcaaggagctctttggtcatttgagcaagttgttgggctgtaagcagaagattattgat
ctactccctaaggtggaagtggccctcagtaacatcaaagaagctgacaatactgttatg
ttcatgcagggaaaaaggcagaaagaaatatggcatctccttaaaattgcctgtacacag
agttctgcccggtcccttgtgggatccagtctagaaggtgcagtaacccctcagacatca
gcatggctgcccccaacttcaacagaacataatcattctttgtcatgtgtggtaactcct
caagatggggagacttcagcacaaatgatagaagaaaatttgaactgccttgacctgtta
agcactattattcatgaggcaaatgaggaagaacaaggcagtagtatgatgagtcttgat
tggagttggttaacagaatga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052971
Entry
101052971         CDS       T04350                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01523  Antifolate resistance
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04062  Chemokine signaling pathway
sbq04064  NF-kappa B signaling pathway
sbq04068  FoxO signaling pathway
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04380  Osteoclast differentiation
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04657  IL-17 signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04668  TNF signaling pathway
sbq04722  Neurotrophin signaling pathway
sbq04910  Insulin signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04930  Type II diabetes mellitus
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease
sbq05010  Alzheimer disease
sbq05132  Salmonella infection
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05206  MicroRNAs in cancer
sbq05212  Pancreatic cancer
sbq05215  Prostate cancer
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05222  Small cell lung cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101052971 (IKBKB)
   04014 Ras signaling pathway
    101052971 (IKBKB)
   04064 NF-kappa B signaling pathway
    101052971 (IKBKB)
   04668 TNF signaling pathway
    101052971 (IKBKB)
   04068 FoxO signaling pathway
    101052971 (IKBKB)
   04151 PI3K-Akt signaling pathway
    101052971 (IKBKB)
   04150 mTOR signaling pathway
    101052971 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101052971 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101052971 (IKBKB)
   04621 NOD-like receptor signaling pathway
    101052971 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    101052971 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    101052971 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    101052971 (IKBKB)
   04660 T cell receptor signaling pathway
    101052971 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    101052971 (IKBKB)
   04659 Th17 cell differentiation
    101052971 (IKBKB)
   04657 IL-17 signaling pathway
    101052971 (IKBKB)
   04662 B cell receptor signaling pathway
    101052971 (IKBKB)
   04062 Chemokine signaling pathway
    101052971 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101052971 (IKBKB)
   04920 Adipocytokine signaling pathway
    101052971 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101052971 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101052971 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101052971 (IKBKB)
   05206 MicroRNAs in cancer
    101052971 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101052971 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101052971 (IKBKB)
   05221 Acute myeloid leukemia
    101052971 (IKBKB)
   05220 Chronic myeloid leukemia
    101052971 (IKBKB)
   05215 Prostate cancer
    101052971 (IKBKB)
   05222 Small cell lung cancer
    101052971 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101052971 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101052971 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101052971 (IKBKB)
   04932 Non-alcoholic fatty liver disease
    101052971 (IKBKB)
   04931 Insulin resistance
    101052971 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101052971 (IKBKB)
   05135 Yersinia infection
    101052971 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101052971 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    101052971 (IKBKB)
   05161 Hepatitis B
    101052971 (IKBKB)
   05160 Hepatitis C
    101052971 (IKBKB)
   05171 Coronavirus disease - COVID-19
    101052971 (IKBKB)
   05164 Influenza A
    101052971 (IKBKB)
   05162 Measles
    101052971 (IKBKB)
   05168 Herpes simplex virus 1 infection
    101052971 (IKBKB)
   05163 Human cytomegalovirus infection
    101052971 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101052971 (IKBKB)
   05169 Epstein-Barr virus infection
    101052971 (IKBKB)
   05165 Human papillomavirus infection
    101052971 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101052971 (IKBKB)
   05142 Chagas disease
    101052971 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101052971 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101052971 (IKBKB)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     101052971 (IKBKB)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101052971 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kdo ubiquitin APH YrbL-PhoP_reg Glyco_hydro_65m Med20
Other DBs
NCBI-GeneID: 101052971
NCBI-ProteinID: XP_010328553
LinkDB
Position
Unknown
AA seq 760 aa
MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRDRWCL
EIQIMRRLSHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQSSLCT
SFVGTLQYLAPELLEQLKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
MDIVVSEDLNGTVKFSSSLPYPNNLNSVLAKRLEKWLQLMLMWHPRQRGTDPTYGPNGCF
KALDDILNLKLVHILNMVTGTIHTYPVTDDESLQSLKARIQQDTGIPEEDQELLQEAGLA
LIPDKPATQCISDSKLNEGRTLDMDLVFLFDNSKITYETQISPRPQPESVSYILQEPKRN
LAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYNEQTEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQS
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNASRLSQPGQLMSQPSTTSDSLPETAKKRSCGDKSDTSFALMKK
NNLRGIGGCCIFNMPVDFQALDWSWLQTEEEEHSCLEQAS
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgagctggtcaccttccctgacaacccagacgtgtggggcctgggaaatgaaagagcgc
cttgggacagggggatttggaaatgtcatccgatggcacaatcaggaaacaggtgagcag
atcgctatcaagcagtgccggcaggagctcagcccgcggaaccgagaccggtggtgcctg
gagatccagatcatgagaaggctgagccaccccaatgtggtggctgctcgggatgtccct
gaggggatgcagaacttggcgcccaatgacctgcccctgctggccatggagtactgccaa
ggaggagatctccggaagtacctgaaccagtttgagaactgctgtggcctgcgggaaggc
gccatcctcaccttgctgagtgacattgcctctgcacttaggtaccttcatgaaaacaga
atcatccatcgggatctaaagccagaaaacatcgtcctgcagcaaggagaacagaggtta
atacacaaaattattgacctaggatatgccaaggagctggatcagagcagtctttgcacg
tcatttgtggggaccctgcagtacctggccccggagctgctggagcagctgaagtacacg
gtgaccgtcgactactggagcttcggcaccctggctttcgagtgcatcacgggcttccgg
cccttcctccccaactggcagcccgtgcagtggcattcgaaagtccgtcagaagagtgag
atggacattgttgtcagtgaggacttgaatggaacagtgaagttttcaagttctttaccc
taccccaataatcttaacagtgtcctggctaagcgactggagaagtggctgcagctgatg
ctgatgtggcacccccggcagaggggcacagatcccacgtatgggcccaacggctgcttc
aaggccctggatgacatcttaaacttaaagctggttcatatcttgaacatggtcacaggc
accatccacacctaccctgtgacagatgacgagagtctgcagagcttgaaggccagaatc
cagcaggacacgggcatcccagaagaggaccaggagctgctgcaggaagcgggcctggcg
ttgatccccgacaagcctgccactcagtgtatttcagacagcaagttaaatgagggccgc
acattggacatggatcttgtttttctcttcgacaacagtaaaatcacgtatgagactcag
atctccccgcggccccaacctgaaagtgtcagctatatccttcaagagcccaagaggaac
cttgccttcttccagctgaggaaggtgtggggccaggtctggcacagcatccagaccctg
aaggaggattgcaaccggctgcagcagggacagcgagctgccatgatgaatctcctccgg
aacaacagctgcctctccaagatgaagaattccatggcttccatgtctcagcagctcaag
gccaagttggatttcttcaaaaccagcatccagattgacctggagaagtacaacgagcaa
accgagtttgggatcacatcagataaactgctgctggcctggagggaaatggagcaggct
gtggagctctgtgggcgggagaatgaagtgaaactcctggtggagcggatgatggcgctg
cagactgacatcgtggacttgcagaggagccccatgggccggaagcagggggggacactg
gatgacctagaggaacaagcaagggagctctacaggagactacgagaaaagccgcgcgac
caacgaactgagggtgacagtcaggaaatggtgcggctgctccttcaggcaattcagagc
ttcgagaagaaagtgcgagtgatctatacacagctcagtaaaactgtggtttgcaagcag
aaggcactagaactgctgcccaaggtggaagaggtggtgagcttgatgaatgaggatgag
aagactgttgtccggctgcaggagaagcggcagaaggaactctggaatctcctgaagatc
gcttgtagcaaggtccgtggtcccgtcagtggaagcccagatagcatgaatgcctctcga
ctcagccagcctgggcagctgatgtctcagccttccacgacctctgacagcttacctgag
acagccaagaagaggtcctgtggggacaaaagtgatacaagttttgctctcatgaagaaa
aataacctgagaggtattggtggctgttgtatttttaacatgcctgttgactttcaggcc
ctagactggagctggttacagacagaagaagaagagcacagctgcctggagcaggcctcg
tga

DBGET integrated database retrieval system